Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2684
Gene name
LocationContig_20:26270..26678
Strand-
Gene length (bp)408
Transcript length (bp)348
Coding sequence length (bp)348
Protein length (aa) 116

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999573

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2396
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2684 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3997
Ophiocordyceps camponoti-floridani Ophcf2|06982
Ophiocordyceps camponoti-rufipedis Ophun1|7261
Ophiocordyceps kimflemingae Ophio5|7250
Ophiocordyceps subramaniannii Hirsu2|3384

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2684
MLFSTLATAITLATGAAASPVARNKHVADFRIYGGTDCFKENKGVWTVIDTDFRPNECKSLNDDSVKSVSVADIN
NGCKLHIFTDSACSKGRETVSQGQCRGSHQGYKAWAMNCS*
Coding >OphauG2|2684
ATGCTCTTCTCAACCCTTGCTACCGCTATTACTCTCGCCACTGGCGCTGCTGCATCCCCCGTCGCTCGCAACAAA
CATGTTGCCGACTTCCGCATCTACGGCGGCACAGACTGCTTCAAGGAAAACAAGGGTGTCTGGACCGTCATTGAC
ACTGACTTTCGCCCCAACGAGTGCAAGAGTCTCAACGACGACTCGGTCAAGTCTGTATCTGTCGCCGACATCAAC
AATGGCTGCAAACTTCACATCTTTACCGACTCTGCTTGCTCAAAGGGACGTGAAACCGTTTCCCAGGGCCAGTGC
CGCGGGTCTCACCAAGGCTACAAGGCCTGGGCAATGAATTGCTCGTAA
Transcript >OphauG2|2684
ATGCTCTTCTCAACCCTTGCTACCGCTATTACTCTCGCCACTGGCGCTGCTGCATCCCCCGTCGCTCGCAACAAA
CATGTTGCCGACTTCCGCATCTACGGCGGCACAGACTGCTTCAAGGAAAACAAGGGTGTCTGGACCGTCATTGAC
ACTGACTTTCGCCCCAACGAGTGCAAGAGTCTCAACGACGACTCGGTCAAGTCTGTATCTGTCGCCGACATCAAC
AATGGCTGCAAACTTCACATCTTTACCGACTCTGCTTGCTCAAAGGGACGTGAAACCGTTTCCCAGGGCCAGTGC
CGCGGGTCTCACCAAGGCTACAAGGCCTGGGCAATGAATTGCTCGTAA
Gene >OphauG2|2684
ATGCTCTTCTCAACCCTTGCTACCGCTATTACTCTCGCCACTGGCGCTGCTGCATCCCCCGTCGCTCGCAACAAA
CATGTTGCCGACTTCCGCATCTACGGCGGCACAGACTGCTTCAAGGAAAACAAGGGTGTCTGGACCGTCATTGAC
ACTGACTTTCGCCCCAACGAGTGCAAGAGTCTCAACGACGACTCGGTCAAGTCTGTATCTGTCGCCGACATCAAC
AATGGCTGCAAACGTAAGTCGTCAAAACCCGCCTTTTGCCTTGTCATCTTCATGTCTAACAATGTGTCTCCAGTT
CACATCTTTACCGACTCTGCTTGCTCAAAGGGACGTGAAACCGTTTCCCAGGGCCAGTGCCGCGGGTCTCACCAA
GGCTACAAGGCCTGGGCAATGAATTGCTCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail