Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2682
Gene name
LocationContig_20:21743..23281
Strand-
Gene length (bp)1538
Transcript length (bp)1479
Coding sequence length (bp)1479
Protein length (aa) 493

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01933 CofD 2-phospho-L-lactate transferase CofD 6.3E-65 30 419

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53980|YNB1_YEAST Uncharacterized protein YNL011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL011C PE=1 SV=1 29 439 4.0E-86

GO

GO Term Description Terminal node
GO:0043743 LPPG:FO 2-phospho-L-lactate transferase activity Yes
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2395
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2682 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3999
Ophiocordyceps camponoti-floridani Ophcf2|06983
Ophiocordyceps camponoti-rufipedis Ophun1|7262
Ophiocordyceps kimflemingae Ophio5|7249
Ophiocordyceps subramaniannii Hirsu2|3382

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2682
MALPGQLGLPLPQVSTANSPLPSPRPSSGIVVFSGGSAANSLVDVFERVREANGSTLSYVLPISDNGGSSSEIIR
VFGGPGIGDVRSRLVRLIPDNVEKPETAALKALFNHRLPASYPKARAEWFDIVDGTHALWDHVSSPRRELIRSIL
NTFNLEVVKRMRPSSRFDFSRASIGNLFLTGARLFSGSFEAAILLLSSICAIPDGVAVIPALNGNFAHHIAAGLA
DGSVITGQNDISHPSAPTAAVPGTGAAVGSAGHDTEEHDKIEDANLPGTLPALRRPAIDFSKHQEEELPARIDRI
WYINPYGQEIRIPANPRVMDAIESADTIVYSIGSLFTSLMPNLVLKGVGQRIAGPLIRNKILILNATNDRETGPS
ANAFSALDFVAAIAHACAYSRGILPVCQEEYALYVTHVIHLDGPAAPKLDKTRFSQLGIETTRLYGPRGSNGNRG
CYDMTALAQTLESIVGRKNVCTDRSRRNTLTAKMEARSGGSK*
Coding >OphauG2|2682
ATGGCCCTGCCAGGACAACTCGGCCTCCCTCTTCCCCAAGTCTCGACAGCCAACAGTCCACTCCCTTCTCCACGG
CCGAGTAGCGGCATCGTCGTCTTCTCTGGAGGCAGCGCGGCCAATAGCCTGGTTGATGTTTTTGAGCGGGTGCGC
GAGGCCAATGGCAGCACCTTGAGTTATGTCCTGCCCATTTCAGATAACGGTGGCAGCTCGAGCGAGATTATTCGC
GTCTTTGGCGGTCCTGGAATTGGCGATGTGCGTTCGCGCCTCGTCCGCCTCATCCCCGATAACGTTGAAAAACCC
GAGACGGCTGCCCTCAAGGCCTTGTTCAATCATCGTCTGCCCGCCTCGTACCCCAAAGCCCGCGCCGAATGGTTC
GATATAGTCGACGGCACCCACGCTCTTTGGGACCATGTATCCTCGCCTCGACGTGAACTCATCCGCTCCATCCTG
AATACCTTTAATCTCGAGGTTGTCAAACGTATGCGACCCAGCAGTCGCTTCGATTTTTCCCGTGCTAGCATTGGC
AATTTGTTCTTGACGGGCGCACGCCTCTTCTCGGGCAGTTTTGAAGCCGCTATTCTCCTCCTTAGTTCTATTTGT
GCAATTCCAGATGGCGTTGCTGTAATTCCAGCCCTTAATGGCAACTTTGCCCATCATATCGCCGCTGGCCTAGCC
GACGGCTCCGTCATTACCGGCCAGAATGACATTTCACATCCCAGCGCCCCAACAGCCGCTGTTCCGGGTACAGGT
GCTGCAGTCGGTAGCGCTGGCCATGACACGGAAGAGCACGACAAGATTGAGGACGCCAACCTGCCAGGCACCTTG
CCCGCCCTGCGAAGGCCGGCCATTGATTTCTCAAAACATCAAGAAGAAGAGCTGCCCGCGCGCATTGACCGCATC
TGGTATATCAATCCCTACGGCCAAGAAATTCGTATTCCCGCCAATCCGCGTGTCATGGATGCCATTGAGAGCGCC
GACACCATTGTCTATAGTATAGGCTCTCTTTTCACCTCACTCATGCCCAACCTCGTTCTCAAGGGGGTGGGTCAG
CGTATCGCCGGCCCGCTCATCCGCAACAAGATACTCATTCTCAATGCAACAAACGACCGCGAGACTGGACCCAGT
GCCAATGCCTTTTCCGCTCTAGATTTTGTAGCTGCCATTGCACACGCCTGTGCATACTCTAGAGGAATCTTGCCC
GTTTGCCAAGAAGAATACGCGCTCTATGTCACCCATGTTATTCACCTTGACGGCCCTGCCGCCCCCAAGCTCGAC
AAGACACGTTTTTCCCAACTAGGCATCGAAACAACGCGGCTTTACGGACCCCGTGGCTCAAACGGAAACAGAGGT
TGCTATGACATGACAGCATTGGCCCAGACTTTGGAATCCATTGTTGGTCGAAAGAATGTGTGTACCGACCGTAGC
CGGCGTAACACCTTGACTGCTAAGATGGAAGCTCGCTCTGGCGGATCAAAGTAA
Transcript >OphauG2|2682
ATGGCCCTGCCAGGACAACTCGGCCTCCCTCTTCCCCAAGTCTCGACAGCCAACAGTCCACTCCCTTCTCCACGG
CCGAGTAGCGGCATCGTCGTCTTCTCTGGAGGCAGCGCGGCCAATAGCCTGGTTGATGTTTTTGAGCGGGTGCGC
GAGGCCAATGGCAGCACCTTGAGTTATGTCCTGCCCATTTCAGATAACGGTGGCAGCTCGAGCGAGATTATTCGC
GTCTTTGGCGGTCCTGGAATTGGCGATGTGCGTTCGCGCCTCGTCCGCCTCATCCCCGATAACGTTGAAAAACCC
GAGACGGCTGCCCTCAAGGCCTTGTTCAATCATCGTCTGCCCGCCTCGTACCCCAAAGCCCGCGCCGAATGGTTC
GATATAGTCGACGGCACCCACGCTCTTTGGGACCATGTATCCTCGCCTCGACGTGAACTCATCCGCTCCATCCTG
AATACCTTTAATCTCGAGGTTGTCAAACGTATGCGACCCAGCAGTCGCTTCGATTTTTCCCGTGCTAGCATTGGC
AATTTGTTCTTGACGGGCGCACGCCTCTTCTCGGGCAGTTTTGAAGCCGCTATTCTCCTCCTTAGTTCTATTTGT
GCAATTCCAGATGGCGTTGCTGTAATTCCAGCCCTTAATGGCAACTTTGCCCATCATATCGCCGCTGGCCTAGCC
GACGGCTCCGTCATTACCGGCCAGAATGACATTTCACATCCCAGCGCCCCAACAGCCGCTGTTCCGGGTACAGGT
GCTGCAGTCGGTAGCGCTGGCCATGACACGGAAGAGCACGACAAGATTGAGGACGCCAACCTGCCAGGCACCTTG
CCCGCCCTGCGAAGGCCGGCCATTGATTTCTCAAAACATCAAGAAGAAGAGCTGCCCGCGCGCATTGACCGCATC
TGGTATATCAATCCCTACGGCCAAGAAATTCGTATTCCCGCCAATCCGCGTGTCATGGATGCCATTGAGAGCGCC
GACACCATTGTCTATAGTATAGGCTCTCTTTTCACCTCACTCATGCCCAACCTCGTTCTCAAGGGGGTGGGTCAG
CGTATCGCCGGCCCGCTCATCCGCAACAAGATACTCATTCTCAATGCAACAAACGACCGCGAGACTGGACCCAGT
GCCAATGCCTTTTCCGCTCTAGATTTTGTAGCTGCCATTGCACACGCCTGTGCATACTCTAGAGGAATCTTGCCC
GTTTGCCAAGAAGAATACGCGCTCTATGTCACCCATGTTATTCACCTTGACGGCCCTGCCGCCCCCAAGCTCGAC
AAGACACGTTTTTCCCAACTAGGCATCGAAACAACGCGGCTTTACGGACCCCGTGGCTCAAACGGAAACAGAGGT
TGCTATGACATGACAGCATTGGCCCAGACTTTGGAATCCATTGTTGGTCGAAAGAATGTGTGTACCGACCGTAGC
CGGCGTAACACCTTGACTGCTAAGATGGAAGCTCGCTCTGGCGGATCAAAGTAA
Gene >OphauG2|2682
ATGGCCCTGCCAGGACAACTCGGCCTCCCTCTTCCCCAAGTCTCGACAGCCAACAGTCCACTCCCTTCTCCACGG
CCGAGTAGCGGCATCGTCGTCTTCTCTGGAGGCAGCGCGGCCAATAGCCTGGTTGATGTTTTTGAGCGGGTGCGC
GAGGCCAATGGCAGCACCTTGAGTTATGTCCTGCCCATTTCAGATAACGGTGGCAGCTCGAGCGAGATTATTCGC
GTCTTTGGCGGTCCTGGTTAGTCACTTCAAACTGTCCTGTGCATCCAATTGCTCACTATTGATGCATCAAATCAG
GAATTGGCGATGTGCGTTCGCGCCTCGTCCGCCTCATCCCCGATAACGTTGAAAAACCCGAGACGGCTGCCCTCA
AGGCCTTGTTCAATCATCGTCTGCCCGCCTCGTACCCCAAAGCCCGCGCCGAATGGTTCGATATAGTCGACGGCA
CCCACGCTCTTTGGGACCATGTATCCTCGCCTCGACGTGAACTCATCCGCTCCATCCTGAATACCTTTAATCTCG
AGGTTGTCAAACGTATGCGACCCAGCAGTCGCTTCGATTTTTCCCGTGCTAGCATTGGCAATTTGTTCTTGACGG
GCGCACGCCTCTTCTCGGGCAGTTTTGAAGCCGCTATTCTCCTCCTTAGTTCTATTTGTGCAATTCCAGATGGCG
TTGCTGTAATTCCAGCCCTTAATGGCAACTTTGCCCATCATATCGCCGCTGGCCTAGCCGACGGCTCCGTCATTA
CCGGCCAGAATGACATTTCACATCCCAGCGCCCCAACAGCCGCTGTTCCGGGTACAGGTGCTGCAGTCGGTAGCG
CTGGCCATGACACGGAAGAGCACGACAAGATTGAGGACGCCAACCTGCCAGGCACCTTGCCCGCCCTGCGAAGGC
CGGCCATTGATTTCTCAAAACATCAAGAAGAAGAGCTGCCCGCGCGCATTGACCGCATCTGGTATATCAATCCCT
ACGGCCAAGAAATTCGTATTCCCGCCAATCCGCGTGTCATGGATGCCATTGAGAGCGCCGACACCATTGTCTATA
GTATAGGCTCTCTTTTCACCTCACTCATGCCCAACCTCGTTCTCAAGGGGGTGGGTCAGCGTATCGCCGGCCCGC
TCATCCGCAACAAGATACTCATTCTCAATGCAACAAACGACCGCGAGACTGGACCCAGTGCCAATGCCTTTTCCG
CTCTAGATTTTGTAGCTGCCATTGCACACGCCTGTGCATACTCTAGAGGAATCTTGCCCGTTTGCCAAGAAGAAT
ACGCGCTCTATGTCACCCATGTTATTCACCTTGACGGCCCTGCCGCCCCCAAGCTCGACAAGACACGTTTTTCCC
AACTAGGCATCGAAACAACGCGGCTTTACGGACCCCGTGGCTCAAACGGAAACAGAGGTTGCTATGACATGACAG
CATTGGCCCAGACTTTGGAATCCATTGTTGGTCGAAAGAATGTGTGTACCGACCGTAGCCGGCGTAACACCTTGA
CTGCTAAGATGGAAGCTCGCTCTGGCGGATCAAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail