Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2680
Gene name
LocationContig_20:18059..19142
Strand+
Gene length (bp)1083
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18457 PUD1_2 Up-Regulated in long-lived daf-2 1.5E-36 27 204

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 232 360 9.0E-08
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 232 360 6.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2680
MNQMICAWLMLIPLFHTGEAVQQNNGCIRIRNEGHQPIVDVNVIHKYESEHSDKHTWGKVYPGVITKGEAGVTYN
TGLGTTGSDWWFITWTSTDEKVYITSPSNAAILKDQYRGALVHFEDMSHILEIAINNILRIQDLPTFEDAVADIE
TGSLIAIAMFNDQSTVGFKQHMLTDEDIEQCTTVVIKEDNSIVLQSLSGSSSTITTATDKELIDAVFAHRYQNTI
PSADTTNCTRFTKVKPSEGCDDVARRAGVHPDFFKYINSLDTECGNLCAGCWACVALKREAMDASITYTPHGTLL
PTIPRNLTCNKFIEMQDDEGCDETALRAGIHPQKFREMNFPDERDCKRSWPNLWACVSTI*
Coding >OphauG2|2680
ATGAACCAAATGATCTGTGCTTGGCTCATGCTTATTCCCTTGTTTCACACTGGAGAGGCAGTTCAACAGAACAAT
GGATGCATCCGGATTAGAAATGAGGGCCACCAGCCCATCGTCGACGTTAATGTCATCCACAAGTACGAAAGCGAG
CATAGCGATAAACATACGTGGGGAAAGGTCTATCCAGGAGTCATAACCAAAGGGGAGGCTGGCGTGACCTATAAC
ACTGGCTTGGGCACCACAGGATCCGACTGGTGGTTCATCACCTGGACTAGCACAGATGAAAAAGTATATATAACA
AGTCCAAGCAACGCAGCCATCTTGAAGGACCAGTACCGCGGAGCACTGGTTCACTTCGAGGATATGAGCCATATT
TTGGAAATTGCGATCAATAACATTTTACGGATACAAGACCTGCCAACGTTTGAAGATGCCGTGGCAGATATTGAA
ACAGGGAGCCTTATAGCCATTGCCATGTTCAACGACCAAAGCACGGTCGGATTCAAACAGCATATGCTCACGGAT
GAAGATATAGAGCAATGCACTACAGTTGTCATTAAAGAAGATAATAGCATCGTACTCCAATCACTTTCAGGCTCT
TCGTCAACAATTACAACGGCTACTGACAAAGAGTTGATCGATGCTGTATTTGCCCATCGCTACCAAAATACTATC
CCTTCGGCCGACACGACAAATTGCACCCGGTTTACCAAGGTTAAGCCTTCTGAAGGGTGCGACGACGTTGCCCGT
CGAGCCGGCGTGCACCCAGACTTTTTCAAATACATCAACTCCCTAGACACTGAATGCGGAAACCTGTGCGCAGGA
TGCTGGGCTTGTGTTGCTCTCAAAAGGGAGGCCATGGACGCCTCAATAACGTATACACCGCATGGGACTCTTTTA
CCCACCATTCCGAGAAATCTAACGTGCAACAAATTCATCGAAATGCAAGACGATGAGGGCTGTGACGAGACTGCG
CTCAGGGCTGGCATACATCCTCAAAAGTTTAGAGAGATGAACTTTCCTGACGAGAGGGACTGTAAAAGATCGTGG
CCGAACCTCTGGGCTTGCGTGTCTACTATTTAA
Transcript >OphauG2|2680
ATGAACCAAATGATCTGTGCTTGGCTCATGCTTATTCCCTTGTTTCACACTGGAGAGGCAGTTCAACAGAACAAT
GGATGCATCCGGATTAGAAATGAGGGCCACCAGCCCATCGTCGACGTTAATGTCATCCACAAGTACGAAAGCGAG
CATAGCGATAAACATACGTGGGGAAAGGTCTATCCAGGAGTCATAACCAAAGGGGAGGCTGGCGTGACCTATAAC
ACTGGCTTGGGCACCACAGGATCCGACTGGTGGTTCATCACCTGGACTAGCACAGATGAAAAAGTATATATAACA
AGTCCAAGCAACGCAGCCATCTTGAAGGACCAGTACCGCGGAGCACTGGTTCACTTCGAGGATATGAGCCATATT
TTGGAAATTGCGATCAATAACATTTTACGGATACAAGACCTGCCAACGTTTGAAGATGCCGTGGCAGATATTGAA
ACAGGGAGCCTTATAGCCATTGCCATGTTCAACGACCAAAGCACGGTCGGATTCAAACAGCATATGCTCACGGAT
GAAGATATAGAGCAATGCACTACAGTTGTCATTAAAGAAGATAATAGCATCGTACTCCAATCACTTTCAGGCTCT
TCGTCAACAATTACAACGGCTACTGACAAAGAGTTGATCGATGCTGTATTTGCCCATCGCTACCAAAATACTATC
CCTTCGGCCGACACGACAAATTGCACCCGGTTTACCAAGGTTAAGCCTTCTGAAGGGTGCGACGACGTTGCCCGT
CGAGCCGGCGTGCACCCAGACTTTTTCAAATACATCAACTCCCTAGACACTGAATGCGGAAACCTGTGCGCAGGA
TGCTGGGCTTGTGTTGCTCTCAAAAGGGAGGCCATGGACGCCTCAATAACGTATACACCGCATGGGACTCTTTTA
CCCACCATTCCGAGAAATCTAACGTGCAACAAATTCATCGAAATGCAAGACGATGAGGGCTGTGACGAGACTGCG
CTCAGGGCTGGCATACATCCTCAAAAGTTTAGAGAGATGAACTTTCCTGACGAGAGGGACTGTAAAAGATCGTGG
CCGAACCTCTGGGCTTGCGTGTCTACTATTTAA
Gene >OphauG2|2680
ATGAACCAAATGATCTGTGCTTGGCTCATGCTTATTCCCTTGTTTCACACTGGAGAGGCAGTTCAACAGAACAAT
GGATGCATCCGGATTAGAAATGAGGGCCACCAGCCCATCGTCGACGTTAATGTCATCCACAAGTACGAAAGCGAG
CATAGCGATAAACATACGTGGGGAAAGGTCTATCCAGGAGTCATAACCAAAGGGGAGGCTGGCGTGACCTATAAC
ACTGGCTTGGGCACCACAGGATCCGACTGGTGGTTCATCACCTGGACTAGCACAGATGAAAAAGTATATATAACA
AGTCCAAGCAACGCAGCCATCTTGAAGGACCAGTACCGCGGAGCACTGGTTCACTTCGAGGATATGAGCCATATT
TTGGAAATTGCGATCAATAACATTTTACGGATACAAGACCTGCCAACGTTTGAAGATGCCGTGGCAGATATTGAA
ACAGGGAGCCTTATAGCCATTGCCATGTTCAACGACCAAAGCACGGTCGGATTCAAACAGCATATGCTCACGGAT
GAAGATATAGAGCAATGCACTACAGTTGTCATTAAAGAAGATAATAGCATCGTACTCCAATCACTTTCAGGCTCT
TCGTCAACAATTACAACGGCTACTGACAAAGAGTTGATCGATGCTGTATTTGCCCATCGCTACCAAAATACTATC
CCTTCGGCCGACACGACAAATTGCACCCGGTTTACCAAGGTTAAGCCTTCTGAAGGGTGCGACGACGTTGCCCGT
CGAGCCGGCGTGCACCCAGACTTTTTCAAATACATCAACTCCCTAGACACTGAATGCGGAAACCTGTGCGCAGGA
TGCTGGGCTTGTGTTGCTCTCAAAAGGGAGGCCATGGACGCCTCAATAACGTATACACCGCATGGGACTCTTTTA
CCCACCATTCCGAGAAATCTAACGTGCAACAAATTCATCGAAATGCAAGACGATGAGGGCTGTGACGAGACTGCG
CTCAGGGCTGGCATACATCCTCAAAAGTTTAGAGAGATGAACTTTCCTGACGAGAGGGACTGTAAAAGATCGTGG
CCGAACCTCTGGGCTTGCGTGTCTACTATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail