Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|266
Gene name
LocationContig_1054:4099..5851
Strand-
Gene length (bp)1752
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 3.4E-18 243 409

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 71 423 6.0E-32
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 71 423 1.0E-31
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 110 414 9.0E-19
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 110 414 1.0E-18
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 72 410 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 71 423 6.0E-32
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 71 423 1.0E-31
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 110 414 9.0E-19
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 110 414 1.0E-18
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 72 410 3.0E-13
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 90 425 7.0E-13
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 87 415 1.0E-12
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 244 426 1.0E-11
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 233 405 3.0E-11
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 244 410 4.0E-11
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 244 410 8.0E-11
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 244 410 1.0E-10
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 244 426 1.0E-10
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 244 426 1.0E-10
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 244 414 1.0E-10
sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 242 410 2.0E-10
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 233 405 2.0E-10
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 78 415 2.0E-10
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 244 418 3.0E-10
sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 244 410 5.0E-10
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 239 410 7.0E-10
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 244 415 8.0E-10
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 244 405 1.0E-09
sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 244 410 1.0E-09
sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 244 410 2.0E-09
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 72 410 2.0E-09
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 244 426 3.0E-09
sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 172 426 3.0E-09
sp|Q54527|RDMB_STREF Aclacinomycin 10-hydroxylase RdmB OS=Streptomyces purpurascens GN=rdmB PE=1 SV=1 87 412 4.0E-09
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 244 426 4.0E-09
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 244 426 5.0E-09
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 198 415 8.0E-09
sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 118 426 9.0E-09
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 244 415 1.0E-08
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 211 410 2.0E-08
sp|Q9XGW0|COMT1_OCIBA Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1 244 410 2.0E-08
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 194 410 3.0E-08
sp|P46484|COMT1_EUCGU Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1 244 410 3.0E-08
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 203 429 6.0E-08
sp|P10950|ASMT_BOVIN Acetylserotonin O-methyltransferase OS=Bos taurus GN=ASMT PE=1 SV=2 88 420 1.0E-07
sp|Q39522|SMT_COPJA (S)-scoulerine 9-O-methyltransferase OS=Coptis japonica GN=SMT PE=1 SV=1 244 416 1.0E-07
sp|Q06528|DNRK_STRPE Carminomycin 4-O-methyltransferase DnrK OS=Streptomyces peucetius GN=dnrK PE=1 SV=2 103 415 1.0E-07
sp|A8QW53|OMT3_SORBI 5-pentadecatrienyl resorcinol O-methyltransferase OS=Sorghum bicolor GN=OMT3 PE=1 SV=1 244 353 2.0E-07
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 116 410 2.0E-07
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 90 377 2.0E-07
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 181 426 2.0E-07
sp|P39896|TCMO_STRGA Tetracenomycin polyketide synthesis 8-O-methyl transferase TcmO OS=Streptomyces glaucescens GN=tcmO PE=3 SV=1 87 361 2.0E-07
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 152 419 2.0E-07
sp|C6TAY1|SOMT2_SOYBN Flavonoid 4'-O-methyltransferase OS=Glycine max PE=1 SV=1 193 426 2.0E-07
sp|Q55216|DNRK_STRS5 Carminomycin 4-O-methyltransferase DauK OS=Streptomyces sp. (strain C5) GN=dauK PE=1 SV=1 103 415 6.0E-07
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 188 410 6.0E-07
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 75 410 9.0E-07
sp|Q84N28|FOMT1_WHEAT Flavone O-methyltransferase 1 OS=Triticum aestivum GN=OMT1 PE=1 SV=1 287 418 1.0E-06
sp|A9X7L0|ANMT_RUTGR Anthranilate N-methyltransferase OS=Ruta graveolens PE=1 SV=1 239 410 2.0E-06
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 244 353 2.0E-06
sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 244 404 2.0E-06
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 246 363 4.0E-06
sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 244 426 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|266
MKPTDQLEALRRLINQSIDTVQQDIALHRDVPLSLEASASHPIRQRHDEHVARALKSLASSGTMLRALSHPHAWL
NDICFGSCDLTALLVACEIDTANLLSRGALDARSIANKTGIDADSITRHLRALCNLYIFSEEAPNVFRNNELSLM
LQPEAVRALVGFLANEGRMASSKQWEVLAQDSGSGRKTAFQVAYDTDLSVYDYWKHVRPDWGKRAAKAFSSNVNN
LEQYLALYPWAKEEDGALVVDVGGGIGGATLPIVRRFPKLRVKVQDREENREGFEEYLENEFPDVAAVDGASFEE
QDYFEANKTRNADIYLLRHIVHNWPDEEASKLLRNVAAAMTRRSKLLLCECVVHAAHRGASHASYTAPEPLLANW
GQTYTSRVDLMMQAMLDARQRSQDEFEALVAGAGLVVTRVWRNMGEEAMVECRLL*
Coding >OphauG2|266
ATGAAGCCAACGGACCAGCTCGAGGCCTTGCGGCGCCTCATCAACCAGTCCATCGACACGGTGCAGCAAGACATT
GCCCTGCACCGCGATGTGCCTCTCAGCCTCGAGGCGTCGGCCAGCCACCCGATTCGCCAGCGGCATGACGAGCAC
GTGGCGCGCGCATTGAAGAGTCTTGCCAGTTCGGGCACGATGCTGAGGGCGCTGAGCCATCCGCACGCGTGGCTA
AACGACATTTGTTTTGGCTCGTGTGACTTGACTGCGCTGCTTGTGGCGTGCGAGATTGACACAGCCAATCTTCTG
AGCAGAGGAGCGCTGGACGCTCGCTCCATTGCCAACAAGACGGGGATTGATGCGGATTCTATTACAAGGCACTTG
CGGGCGCTTTGCAATCTTTATATTTTTAGTGAAGAGGCGCCAAATGTGTTTAGAAACAATGAGTTGTCTCTGATG
CTGCAGCCAGAGGCAGTCAGGGCTCTTGTTGGTTTTCTTGCCAACGAGGGCCGCATGGCGAGTAGCAAGCAGTGG
GAGGTGCTGGCGCAGGACAGCGGGAGCGGGAGGAAAACAGCCTTTCAAGTCGCATACGACACCGACTTGAGCGTG
TACGACTACTGGAAGCATGTGCGGCCAGACTGGGGGAAAAGAGCAGCAAAGGCGTTTTCGAGCAATGTGAATAAC
CTTGAGCAGTACTTGGCATTGTATCCGTGGGCAAAAGAAGAAGACGGGGCGCTGGTGGTGGATGTTGGGGGAGGG
ATCGGGGGCGCCACGTTGCCGATAGTGAGACGGTTTCCAAAGCTGAGGGTCAAGGTGCAGGACCGAGAGGAAAAC
CGAGAGGGGTTTGAAGAGTACCTGGAAAACGAGTTTCCCGACGTGGCGGCAGTCGACGGAGCGAGTTTTGAAGAA
CAAGACTACTTCGAGGCCAACAAGACGCGCAATGCCGACATTTACCTTCTCCGCCACATTGTGCACAACTGGCCG
GACGAGGAAGCCAGCAAGCTGCTCCGCAACGTAGCAGCAGCAATGACGCGTCGCAGCAAATTACTGCTCTGCGAA
TGCGTGGTGCATGCAGCGCATCGAGGGGCGTCGCACGCATCGTATACAGCGCCAGAGCCGCTCCTAGCAAACTGG
GGACAGACGTACACGAGCCGTGTCGATCTCATGATGCAGGCGATGCTGGACGCGAGACAGCGCAGCCAAGACGAG
TTTGAAGCGTTGGTGGCTGGGGCTGGGCTTGTGGTGACGCGGGTGTGGCGAAACATGGGAGAGGAGGCCATGGTT
GAGTGTCGGTTGTTGTGA
Transcript >OphauG2|266
ATGAAGCCAACGGACCAGCTCGAGGCCTTGCGGCGCCTCATCAACCAGTCCATCGACACGGTGCAGCAAGACATT
GCCCTGCACCGCGATGTGCCTCTCAGCCTCGAGGCGTCGGCCAGCCACCCGATTCGCCAGCGGCATGACGAGCAC
GTGGCGCGCGCATTGAAGAGTCTTGCCAGTTCGGGCACGATGCTGAGGGCGCTGAGCCATCCGCACGCGTGGCTA
AACGACATTTGTTTTGGCTCGTGTGACTTGACTGCGCTGCTTGTGGCGTGCGAGATTGACACAGCCAATCTTCTG
AGCAGAGGAGCGCTGGACGCTCGCTCCATTGCCAACAAGACGGGGATTGATGCGGATTCTATTACAAGGCACTTG
CGGGCGCTTTGCAATCTTTATATTTTTAGTGAAGAGGCGCCAAATGTGTTTAGAAACAATGAGTTGTCTCTGATG
CTGCAGCCAGAGGCAGTCAGGGCTCTTGTTGGTTTTCTTGCCAACGAGGGCCGCATGGCGAGTAGCAAGCAGTGG
GAGGTGCTGGCGCAGGACAGCGGGAGCGGGAGGAAAACAGCCTTTCAAGTCGCATACGACACCGACTTGAGCGTG
TACGACTACTGGAAGCATGTGCGGCCAGACTGGGGGAAAAGAGCAGCAAAGGCGTTTTCGAGCAATGTGAATAAC
CTTGAGCAGTACTTGGCATTGTATCCGTGGGCAAAAGAAGAAGACGGGGCGCTGGTGGTGGATGTTGGGGGAGGG
ATCGGGGGCGCCACGTTGCCGATAGTGAGACGGTTTCCAAAGCTGAGGGTCAAGGTGCAGGACCGAGAGGAAAAC
CGAGAGGGGTTTGAAGAGTACCTGGAAAACGAGTTTCCCGACGTGGCGGCAGTCGACGGAGCGAGTTTTGAAGAA
CAAGACTACTTCGAGGCCAACAAGACGCGCAATGCCGACATTTACCTTCTCCGCCACATTGTGCACAACTGGCCG
GACGAGGAAGCCAGCAAGCTGCTCCGCAACGTAGCAGCAGCAATGACGCGTCGCAGCAAATTACTGCTCTGCGAA
TGCGTGGTGCATGCAGCGCATCGAGGGGCGTCGCACGCATCGTATACAGCGCCAGAGCCGCTCCTAGCAAACTGG
GGACAGACGTACACGAGCCGTGTCGATCTCATGATGCAGGCGATGCTGGACGCGAGACAGCGCAGCCAAGACGAG
TTTGAAGCGTTGGTGGCTGGGGCTGGGCTTGTGGTGACGCGGGTGTGGCGAAACATGGGAGAGGAGGCCATGGTT
GAGTGTCGGTTGTTGTGA
Gene >OphauG2|266
ATGAAGCCAACGGACCAGCTCGAGGCCTTGCGGCGCCTCATCAACCAGTCCATCGACACGGTGCAGCAAGACATT
GCCCTGCACCGCGATGTGCCTCTCAGCCTCGAGGCGTCGGCCAGCCACCCGATTCGCCAGCGGCATGACGAGCAC
GTGGCGCGCGCATTGAAGAGTCTTGCCAGTTCGGGCACGATGCTGAGGGCGCTGAGCCATCCGCACGCGTGGCTA
AACGACATTTGTTTTGGCGTGAGACTCTTTTCTCTTTTCTCACTCACTCACACACACACACTCTCACACTCTCAT
ACTCTCTCTCTCTCTCTCTCTCTCTCTTCTTCTTTTATTGCAATTACAGGCCCTAACTTTGCCAATAGTCGTGTG
ACTTGACTGCGCTGCTTGTGGCGTGCGAGATTGACACAGCCAATCTTCTGAGCAGAGGAGCGCTGGACGCTCGCT
CCATTGCCAACAAGACGGGGATTGATGCGGATTCTATTACAAGGCACTTGCGGGCGCTTTGCAATCTTTATATTT
TTAGTGAAGAGGCGCCAAATGTGTTTAGAAACAATGAGTTGTCTCTGATGCTGCAGCCAGAGGCAGTCAGGGCTC
TTGTTGGTTTTCTGTGAGTTTTTTTTTCTTTCTTGAAACTATGGTTGCCTCTCCCTTTTTTTTTACTCAACAAGA
AAAAGAAGAGAGAATTTGGTTGACACGGAGAGGGGGGTTTCTCTTTTAACAGTGCCAACGAGGGCCGCATGGCGA
GTAGCAAGCAGTGGGAGGTGCTGGCGCAGGACAGCGGGAGCGGGAGGAAAACAGCCTTTCAAGTCGCATACGACA
CCGACTTGAGCGTGTACGACTACTGGAAGCATGTGCGGCCAGACTGGGGGAAAAGAGCAGCAAAGGCGTTTTCGA
GCAATGTGAATAACCTTGAGCAGTACTTGGCATGTGAGTCGGGGCTTTTTTTGATTTTTTTTTGATTTTTGATTT
TTTTTAACGTGGGGAAGAGTTTTGTGAGTTTTGGGGGAGGTTTTGAACTGACAAGAGGCGTCGTGGTAGTGTATC
CGTGGGCAAAAGAAGAAGACGGGGCGCTGGTGGTGGATGTTGGGGGAGGGATCGGGGGCGCCACGTTGCCGATAG
TGAGACGGTTTCCAAAGCTGAGGGTCAAGGTGCAGGACCGAGAGGAAAACCGAGAGGGGTTTGAAGAGGTGGGTG
AAGCTAAAGAGGCAGAGGCAGAGAGGCAGAGGAGAAGAAGTCCAAGAGGAAGAGACAGAGACAACGAGGAAAAGA
GGAAAAGAGGAGCTAACACATCAGCAGTACCTGGAAAACGAGTTTCCCGACGTGGCGGCAGTCGACGGAGCGAGT
TTTGAAGAACAAGACTACTTCGAGGCCAACAAGACGCGCAATGCCGACATTTACCTTCTCCGCCACATTGTGCAC
AACTGGCCGGACGAGGAAGCCAGCAAGCTGCTCCGCAACGTAGCAGCAGCAATGACGCGTCGCAGCAAATTACTG
CTCTGCGAATGCGTGGTGCATGCAGCGCATCGAGGGGCGTCGCACGCATCGTATACAGCGCCAGAGCCGCTCCTA
GCAAACTGGGGACAGACGTACACGAGCCGTGTCGATCTCATGATGCAGGCGATGCTGGACGCGAGACAGCGCAGC
CAAGACGAGTTTGAAGCGTTGGTGGCTGGGGCTGGGCTTGTGGTGACGCGGGTGTGGCGAAACATGGGAGAGGAG
GCCATGGTTGAGTGTCGGTTGTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail