Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2649
Gene name
LocationContig_2:47144..48162
Strand+
Gene length (bp)1018
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04934 Med6 MED6 mediator sub complex component 1.7E-37 12 164

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HED8|MED6_NEUCR Mediator of RNA polymerase II transcription subunit 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-6 PE=3 SV=1 7 254 8.0E-85
sp|Q2U9E7|MED6_ASPOR Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=med6 PE=3 SV=1 1 252 1.0E-67
sp|Q0CH76|MED6_ASPTN Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=med6 PE=3 SV=2 1 313 2.0E-67
sp|Q5AYT1|MED6_EMENI Mediator of RNA polymerase II transcription subunit 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=med6 PE=3 SV=2 1 309 4.0E-67
sp|Q4WDH9|MED6_ASPFU Mediator of RNA polymerase II transcription subunit 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=med6 PE=3 SV=1 1 249 2.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HED8|MED6_NEUCR Mediator of RNA polymerase II transcription subunit 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-6 PE=3 SV=1 7 254 8.0E-85
sp|Q2U9E7|MED6_ASPOR Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=med6 PE=3 SV=1 1 252 1.0E-67
sp|Q0CH76|MED6_ASPTN Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=med6 PE=3 SV=2 1 313 2.0E-67
sp|Q5AYT1|MED6_EMENI Mediator of RNA polymerase II transcription subunit 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=med6 PE=3 SV=2 1 309 4.0E-67
sp|Q4WDH9|MED6_ASPFU Mediator of RNA polymerase II transcription subunit 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=med6 PE=3 SV=1 1 249 2.0E-64
sp|A2R4I0|MED6_ASPNC Mediator of RNA polymerase II transcription subunit 6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=med6 PE=3 SV=2 6 249 3.0E-63
sp|Q1E3Z7|MED6_COCIM Mediator of RNA polymerase II transcription subunit 6 OS=Coccidioides immitis (strain RS) GN=MED6 PE=3 SV=2 1 246 8.0E-53
sp|Q6C3T0|MED6_YARLI Mediator of RNA polymerase II transcription subunit 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED6 PE=3 SV=1 9 172 1.0E-26
sp|Q5A2Z1|MED6_CANAL Mediator of RNA polymerase II transcription subunit 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED6 PE=3 SV=1 9 172 9.0E-24
sp|Q6BIH7|MED6_DEBHA Mediator of RNA polymerase II transcription subunit 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MED6 PE=3 SV=2 8 242 5.0E-21
sp|Q75EY3|MED6_ASHGO Mediator of RNA polymerase II transcription subunit 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MED6 PE=3 SV=1 5 189 1.0E-19
sp|Q9US45|MED6_SCHPO Mediator of RNA polymerase II transcription subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=med6 PE=1 SV=1 9 232 6.0E-19
sp|Q6FW12|MED6_CANGA Mediator of RNA polymerase II transcription subunit 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MED6 PE=3 SV=1 6 175 3.0E-17
sp|Q6CTT6|MED6_KLULA Mediator of RNA polymerase II transcription subunit 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MED6 PE=3 SV=1 7 169 4.0E-17
sp|P38782|MED6_YEAST Mediator of RNA polymerase II transcription subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED6 PE=1 SV=1 5 177 5.0E-16
sp|A3LQ10|MED6_PICST Mediator of RNA polymerase II transcription subunit 6 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MED6 PE=3 SV=2 9 206 6.0E-15
sp|Q4PHA6|MED6_USTMA Mediator of RNA polymerase II transcription subunit 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MED6 PE=3 SV=1 26 234 1.0E-12
sp|Q54PN3|MED6_DICDI Putative mediator of RNA polymerase II transcription subunit 6 OS=Dictyostelium discoideum GN=med6 PE=3 SV=1 6 191 2.0E-11
sp|Q7Q107|MED6_ANOGA Mediator of RNA polymerase II transcription subunit 6 OS=Anopheles gambiae GN=MED6 PE=3 SV=3 26 201 3.0E-11
sp|Q921D4|MED6_MOUSE Mediator of RNA polymerase II transcription subunit 6 OS=Mus musculus GN=Med6 PE=1 SV=2 26 193 1.0E-10
sp|Q5RD94|MED6_PONAB Mediator of RNA polymerase II transcription subunit 6 OS=Pongo abelii GN=MED6 PE=2 SV=1 26 193 2.0E-10
sp|O75586|MED6_HUMAN Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens GN=MED6 PE=1 SV=2 26 193 3.0E-10
sp|Q3SZY9|MED6_BOVIN Mediator of RNA polymerase II transcription subunit 6 OS=Bos taurus GN=MED6 PE=2 SV=1 26 193 3.0E-10
sp|Q8MSX2|MED6_DROME Mediator of RNA polymerase II transcription subunit 6 OS=Drosophila melanogaster GN=MED6 PE=1 SV=1 23 206 6.0E-10
sp|F4IXJ7|MED6_ARATH Mediator of RNA polymerase II transcription subunit 6 OS=Arabidopsis thaliana GN=MED6 PE=1 SV=1 26 162 1.0E-08
sp|Q6IQ63|MED6_DANRE Mediator of RNA polymerase II transcription subunit 6 OS=Danio rerio GN=med6 PE=2 SV=1 26 172 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016592 mediator complex Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0003712 transcription coregulator activity Yes
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0032991 protein-containing complex No
GO:0006355 regulation of transcription, DNA-templated No
GO:0009889 regulation of biosynthetic process No
GO:0005575 cellular_component No
GO:0065007 biological regulation No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4001
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2649 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1626
Ophiocordyceps camponoti-floridani Ophcf2|05856
Ophiocordyceps camponoti-rufipedis Ophun1|929
Ophiocordyceps kimflemingae Ophio5|2579
Ophiocordyceps subramaniannii Hirsu2|8029

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2649
MDSANDPPLDEIQWRSPPIVAQMGGLHSNTILFYFAESPFFERTSNNAVIMSQALNNMSMYHYIQTREAFEGRLK
TMSGLEFIVGEEPAETGPGAGTGVWVIRKQTRRKRYQEPDEITVHASFFIVGENIYKSPSLANILASRIMTISTA
MAMALPAAEKARSWRAATGHVYRPLPTTQSASKPKAQTSKENSPTADAPKSASASTSRNNDEASLERAAEEAFMT
HMRHGSEYIDENPITGRPGDFHLSSTGRKAVLPPPPPKTDQSLGIGAMNGPAPINTKLEDRRDSKTDKTPKSATH
PKPKRRKSKMSNGPTPAQTPTAS*
Coding >OphauG2|2649
ATGGACTCGGCCAACGACCCCCCCCTCGACGAGATTCAATGGCGCTCACCGCCCATCGTCGCCCAGATGGGTGGC
CTTCACTCCAACACTATTCTCTTCTACTTTGCCGAATCGCCATTCTTCGAGCGCACCTCCAACAACGCCGTCATT
ATGAGCCAAGCCCTCAACAACATGTCCATGTACCACTACATCCAGACGCGAGAGGCCTTTGAGGGCCGCCTCAAG
ACCATGTCGGGCCTGGAATTCATTGTTGGCGAAGAGCCGGCCGAGACGGGGCCTGGCGCCGGCACTGGCGTCTGG
GTCATTCGCAAGCAGACGCGTCGCAAACGCTACCAGGAACCCGACGAAATCACTGTCCACGCCTCGTTTTTCATT
GTCGGCGAAAACATTTACAAGTCGCCCAGCTTAGCAAACATTCTGGCGTCTCGCATCATGACTATTTCCACCGCC
ATGGCCATGGCACTGCCTGCCGCTGAAAAGGCGCGCAGCTGGCGCGCAGCCACGGGCCATGTTTATCGCCCACTA
CCCACCACGCAATCAGCGTCCAAGCCCAAGGCCCAAACGTCAAAGGAGAATTCGCCCACAGCCGACGCCCCAAAG
TCGGCATCGGCATCGACATCGAGAAACAATGACGAGGCTTCTCTGGAGAGAGCAGCCGAAGAGGCTTTCATGACG
CATATGCGCCATGGCAGCGAGTATATTGACGAAAATCCCATCACTGGACGGCCCGGAGATTTTCACCTCAGCTCA
ACAGGACGCAAAGCTGTCCTGCCTCCTCCGCCCCCAAAGACGGACCAATCCCTTGGCATTGGGGCCATGAATGGC
CCAGCGCCAATCAATACCAAGCTCGAAGACAGAAGAGACAGCAAAACAGACAAGACGCCCAAATCGGCCACTCAT
CCTAAGCCTAAGAGAAGGAAAAGCAAGATGAGCAACGGACCGACTCCGGCGCAGACTCCAACGGCGTCGTAA
Transcript >OphauG2|2649
ATGGACTCGGCCAACGACCCCCCCCTCGACGAGATTCAATGGCGCTCACCGCCCATCGTCGCCCAGATGGGTGGC
CTTCACTCCAACACTATTCTCTTCTACTTTGCCGAATCGCCATTCTTCGAGCGCACCTCCAACAACGCCGTCATT
ATGAGCCAAGCCCTCAACAACATGTCCATGTACCACTACATCCAGACGCGAGAGGCCTTTGAGGGCCGCCTCAAG
ACCATGTCGGGCCTGGAATTCATTGTTGGCGAAGAGCCGGCCGAGACGGGGCCTGGCGCCGGCACTGGCGTCTGG
GTCATTCGCAAGCAGACGCGTCGCAAACGCTACCAGGAACCCGACGAAATCACTGTCCACGCCTCGTTTTTCATT
GTCGGCGAAAACATTTACAAGTCGCCCAGCTTAGCAAACATTCTGGCGTCTCGCATCATGACTATTTCCACCGCC
ATGGCCATGGCACTGCCTGCCGCTGAAAAGGCGCGCAGCTGGCGCGCAGCCACGGGCCATGTTTATCGCCCACTA
CCCACCACGCAATCAGCGTCCAAGCCCAAGGCCCAAACGTCAAAGGAGAATTCGCCCACAGCCGACGCCCCAAAG
TCGGCATCGGCATCGACATCGAGAAACAATGACGAGGCTTCTCTGGAGAGAGCAGCCGAAGAGGCTTTCATGACG
CATATGCGCCATGGCAGCGAGTATATTGACGAAAATCCCATCACTGGACGGCCCGGAGATTTTCACCTCAGCTCA
ACAGGACGCAAAGCTGTCCTGCCTCCTCCGCCCCCAAAGACGGACCAATCCCTTGGCATTGGGGCCATGAATGGC
CCAGCGCCAATCAATACCAAGCTCGAAGACAGAAGAGACAGCAAAACAGACAAGACGCCCAAATCGGCCACTCAT
CCTAAGCCTAAGAGAAGGAAAAGCAAGATGAGCAACGGACCGACTCCGGCGCAGACTCCAACGGCGTCGTAA
Gene >OphauG2|2649
ATGGACTCGGCCAACGACCCCCCCCTCGACGAGATTCAATGGCGCTCACCGCCCATCGTCGCCCAGATGGGTGGC
CTTCACTCCAACACTATTCTCTTCTACTTTGCCGAATCGCCATTCTTCGAGCGCACCTCCAACAACGCCGTCATT
ATGAGCCAAGCCCTCAACAACATGTCCATGTACCACTACATCCAGACGCGAGAGGCCTTTGAGGGCCGCCTCAAG
ACCATGTCGGGCCTGGAATTCATTGTTGGCGAAGAGCCGGCCGAGACGGGGCCTGGCGCCGGCACTGGCGTCTGG
GTCATTCGCAAGCAGACGCGTCGCAAACGCTACCAGGAACCCGACGAAATCACTGTCCACGCCTCGTTTTTCATT
GTCGGCGAAAACATTTACAAGTCGCCCAGCTTAGCAAACATTCTGGCGTCTCGCATCGTCAGTCTATCTAGCCTC
GTTGCAGCGACTGGTGCTGACGAATTAGATGACTATTTCCACCGCCATGGCCATGGCACTGCCTGCCGCTGAAAA
GGCGCGCAGCTGGCGCGCAGCCACGGGCCATGTTTATCGCCCACTACCCACCACGCAATCAGCGTCCAAGCCCAA
GGCCCAAACGTCAAAGGAGAATTCGCCCACAGCCGACGCCCCAAAGTCGGCATCGGCATCGACATCGAGAAACAA
TGACGAGGCTTCTCTGGAGAGAGCAGCCGAAGAGGCTTTCATGACGCATATGCGCCATGGCAGCGAGTATATTGA
CGAAAATCCCATCACTGGACGGCCCGGAGATTTTCACCTCAGCTCAACAGGACGCAAAGCTGTCCTGCCTCCTCC
GCCCCCAAAGACGGACCAATCCCTTGGCATTGGGGCCATGAATGGCCCAGCGCCAATCAATACCAAGCTCGAAGA
CAGAAGAGACAGCAAAACAGACAAGACGCCCAAATCGGCCACTCATCCTAAGCCTAAGAGAAGGAAAAGCAAGAT
GAGCAACGGACCGACTCCGGCGCAGACTCCAACGGCGTCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail