Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2643
Gene name
LocationContig_2:34009..35642
Strand+
Gene length (bp)1633
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.4E-11 122 362
PF12146 Hydrolase_4 Serine aminopeptidase, S33 3.3E-08 120 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03649|YM60_YEAST Putative esterase YMR210W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR210W PE=1 SV=1 46 400 2.0E-69
sp|Q02891|MCFS1_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EEB1 PE=1 SV=1 42 381 1.0E-56
sp|P38295|MCFS2_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHT1 PE=1 SV=1 42 381 9.0E-51
sp|Q40863|EMB8_PICGL Embryogenesis-associated protein EMB8 OS=Picea glauca GN=EMB8 PE=2 SV=1 45 364 5.0E-39
sp|Q54H38|ABHD_DICDI Abhydrolase domain-containing protein OS=Dictyostelium discoideum GN=abhd PE=1 SV=1 122 364 2.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03649|YM60_YEAST Putative esterase YMR210W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR210W PE=1 SV=1 46 400 2.0E-69
sp|Q02891|MCFS1_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EEB1 PE=1 SV=1 42 381 1.0E-56
sp|P38295|MCFS2_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHT1 PE=1 SV=1 42 381 9.0E-51
sp|Q40863|EMB8_PICGL Embryogenesis-associated protein EMB8 OS=Picea glauca GN=EMB8 PE=2 SV=1 45 364 5.0E-39
sp|Q54H38|ABHD_DICDI Abhydrolase domain-containing protein OS=Dictyostelium discoideum GN=abhd PE=1 SV=1 122 364 2.0E-34
sp|Q5RK23|ABHD1_RAT Abhydrolase domain-containing protein 1 OS=Rattus norvegicus GN=Abhd1 PE=2 SV=1 48 366 5.0E-29
sp|Q9QZC8|ABHD1_MOUSE Abhydrolase domain-containing protein 1 OS=Mus musculus GN=Abhd1 PE=1 SV=2 48 366 6.0E-29
sp|Q91ZH7|ABHD3_MOUSE Phospholipase ABHD3 OS=Mus musculus GN=Abhd3 PE=1 SV=1 112 366 2.0E-28
sp|Q8WU67|ABHD3_HUMAN Phospholipase ABHD3 OS=Homo sapiens GN=ABHD3 PE=1 SV=2 112 366 3.0E-28
sp|Q0VC00|ABHD3_BOVIN Phospholipase ABHD3 OS=Bos taurus GN=ABHD3 PE=2 SV=1 106 366 2.0E-27
sp|Q96SE0|ABHD1_HUMAN Abhydrolase domain-containing protein 1 OS=Homo sapiens GN=ABHD1 PE=1 SV=2 48 398 3.0E-27
sp|Q3T0A0|ABHD1_BOVIN Abhydrolase domain-containing protein 1 OS=Bos taurus GN=ABHD1 PE=2 SV=1 48 366 1.0E-25
sp|Q18610|YYC5_CAEEL Putative esterase C44C1.5 OS=Caenorhabditis elegans GN=C44C1.5 PE=3 SV=1 116 366 2.0E-25
sp|P45524|YHET_ECOLI Putative esterase YheT OS=Escherichia coli (strain K12) GN=yheT PE=3 SV=1 113 373 3.0E-24
sp|Q5EA42|ABHD2_BOVIN Abhydrolase domain-containing protein 2 OS=Bos taurus GN=ABHD2 PE=2 SV=1 124 377 3.0E-18
sp|Q9QXM0|ABHD2_MOUSE Abhydrolase domain-containing protein 2 OS=Mus musculus GN=Abhd2 PE=1 SV=1 124 377 3.0E-18
sp|P08910|ABHD2_HUMAN Abhydrolase domain-containing protein 2 OS=Homo sapiens GN=ABHD2 PE=2 SV=1 124 377 6.0E-18
sp|Q4R2Y9|ABHD2_MACFA Abhydrolase domain-containing protein 2 OS=Macaca fascicularis GN=ABHD2 PE=2 SV=1 124 377 7.0E-18
sp|Q05AK6|ABH2B_DANRE Abhydrolase domain-containing protein 2-B OS=Danio rerio GN=abhd2b PE=2 SV=1 30 377 3.0E-17
sp|Q802V6|ABH2A_DANRE Abhydrolase domain-containing protein 2-A OS=Danio rerio GN=abhd2a PE=2 SV=1 124 377 2.0E-16
sp|Q24093|ABHD2_DROME Abhydrolase domain-containing protein 2 OS=Drosophila melanogaster GN=Hydr2 PE=2 SV=2 129 395 6.0E-16
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4678
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2643 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5539
Ophiocordyceps camponoti-floridani Ophcf2|00581
Ophiocordyceps camponoti-rufipedis Ophun1|325
Ophiocordyceps kimflemingae Ophio5|7611
Ophiocordyceps subramaniannii Hirsu2|9858

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2643
MEWLGRAKINFTHAPNPRPLKQQDGRETDLLKICEEITPSCQLNPLLFNGHLQTIWTVTKPNGPKVYYRRKVFDA
DHKVYRGTFAVDFAVRPFEDHDETLPRRTVYFTDEEFDNIGSTDKRPMLVVLHGLSGGSHEVYLRHAIAPLLESG
EWEVCVVNSRGCARSKITSGVLYNARATWDIRQTVKWLHETFPNRPLFGLGFSLGANMLTNYCGEEGSNCLFKAA
IACSNPFSLEISSKMLQHSFIGREVYLRVMGTAMKNVIKTHQKELEKYSNLDLAAIDKITYLQEFDREVQCPAWG
YPTEYAYYRDASSTDAVMAIRIPFMALQATDDPIAVNEAVPYAEFQQNPSTVLVTTSLGGHLSWFEMGGSRWHSR
PLCNFLNHMAFKVDLESVTPLSDPSTADELSHGTEYNPMRRKLNIIED*
Coding >OphauG2|2643
ATGGAGTGGCTAGGACGAGCCAAGATCAACTTCACTCATGCTCCGAACCCTCGGCCCCTGAAACAACAAGATGGC
AGAGAAACAGATTTGCTCAAGATTTGCGAAGAGATAACCCCCTCGTGTCAACTTAACCCCTTGCTCTTTAATGGC
CATTTGCAGACCATATGGACAGTCACGAAGCCTAATGGGCCCAAGGTCTACTATCGACGCAAGGTCTTCGATGCC
GATCATAAAGTCTATCGCGGTACTTTTGCCGTTGACTTTGCCGTGCGTCCTTTCGAGGATCACGACGAGACACTT
CCCCGAAGAACTGTCTACTTTACTGATGAAGAGTTTGACAACATTGGCTCTACCGATAAGAGGCCCATGCTTGTT
GTTCTCCATGGCCTCTCGGGTGGCTCTCATGAAGTCTATCTTCGGCATGCCATAGCCCCCTTGCTCGAAAGCGGC
GAGTGGGAGGTTTGCGTTGTCAACTCGCGAGGATGTGCGCGTAGCAAAATTACCAGTGGCGTGCTCTACAATGCC
CGTGCCACATGGGACATTCGCCAAACTGTAAAATGGCTGCACGAGACTTTTCCCAACCGTCCCCTCTTCGGTCTT
GGATTCTCTCTTGGAGCCAATATGCTTACAAACTACTGCGGCGAAGAGGGATCAAACTGCCTCTTCAAGGCGGCA
ATCGCCTGCTCAAACCCATTTAGCCTGGAAATATCTAGCAAGATGCTTCAGCACAGTTTTATCGGCAGAGAAGTC
TATCTTCGGGTCATGGGCACCGCCATGAAAAACGTCATCAAGACTCATCAAAAGGAGTTGGAAAAATACTCTAAT
CTCGACTTGGCAGCGATAGACAAAATCACTTACTTGCAGGAATTCGATCGCGAGGTTCAGTGCCCAGCTTGGGGC
TATCCGACCGAATACGCTTATTATCGCGATGCCTCATCTACAGATGCTGTCATGGCAATTCGTATACCCTTCATG
GCTCTACAGGCCACTGACGACCCTATTGCTGTCAATGAGGCCGTTCCTTATGCCGAGTTCCAGCAGAACCCAAGT
ACCGTTCTTGTTACGACTTCTCTGGGAGGACACTTGTCCTGGTTCGAGATGGGAGGTTCCCGCTGGCACAGTCGT
CCGCTGTGTAACTTTTTGAATCACATGGCATTCAAAGTCGACTTGGAAAGTGTCACGCCGCTGTCTGACCCCTCA
ACAGCTGATGAGCTGTCGCATGGCACCGAATATAATCCCATGCGTCGAAAATTGAATATTATCGAGGATTGA
Transcript >OphauG2|2643
ATGGAGTGGCTAGGACGAGCCAAGATCAACTTCACTCATGCTCCGAACCCTCGGCCCCTGAAACAACAAGATGGC
AGAGAAACAGATTTGCTCAAGATTTGCGAAGAGATAACCCCCTCGTGTCAACTTAACCCCTTGCTCTTTAATGGC
CATTTGCAGACCATATGGACAGTCACGAAGCCTAATGGGCCCAAGGTCTACTATCGACGCAAGGTCTTCGATGCC
GATCATAAAGTCTATCGCGGTACTTTTGCCGTTGACTTTGCCGTGCGTCCTTTCGAGGATCACGACGAGACACTT
CCCCGAAGAACTGTCTACTTTACTGATGAAGAGTTTGACAACATTGGCTCTACCGATAAGAGGCCCATGCTTGTT
GTTCTCCATGGCCTCTCGGGTGGCTCTCATGAAGTCTATCTTCGGCATGCCATAGCCCCCTTGCTCGAAAGCGGC
GAGTGGGAGGTTTGCGTTGTCAACTCGCGAGGATGTGCGCGTAGCAAAATTACCAGTGGCGTGCTCTACAATGCC
CGTGCCACATGGGACATTCGCCAAACTGTAAAATGGCTGCACGAGACTTTTCCCAACCGTCCCCTCTTCGGTCTT
GGATTCTCTCTTGGAGCCAATATGCTTACAAACTACTGCGGCGAAGAGGGATCAAACTGCCTCTTCAAGGCGGCA
ATCGCCTGCTCAAACCCATTTAGCCTGGAAATATCTAGCAAGATGCTTCAGCACAGTTTTATCGGCAGAGAAGTC
TATCTTCGGGTCATGGGCACCGCCATGAAAAACGTCATCAAGACTCATCAAAAGGAGTTGGAAAAATACTCTAAT
CTCGACTTGGCAGCGATAGACAAAATCACTTACTTGCAGGAATTCGATCGCGAGGTTCAGTGCCCAGCTTGGGGC
TATCCGACCGAATACGCTTATTATCGCGATGCCTCATCTACAGATGCTGTCATGGCAATTCGTATACCCTTCATG
GCTCTACAGGCCACTGACGACCCTATTGCTGTCAATGAGGCCGTTCCTTATGCCGAGTTCCAGCAGAACCCAAGT
ACCGTTCTTGTTACGACTTCTCTGGGAGGACACTTGTCCTGGTTCGAGATGGGAGGTTCCCGCTGGCACAGTCGT
CCGCTGTGTAACTTTTTGAATCACATGGCATTCAAAGTCGACTTGGAAAGTGTCACGCCGCTGTCTGACCCCTCA
ACAGCTGATGAGCTGTCGCATGGCACCGAATATAATCCCATGCGTCGAAAATTGAATATTATCGAGGATTGA
Gene >OphauG2|2643
ATGGAGTGGCTAGGACGAGCCAAGATCAACTTCACTCATGCTCCGAACCCTCGGCCCCTGAAACAACAAGATGGC
AGAGAAACAGATTTGCTCAAGATTTGCGAAGAGATAACCCCCTCGTGTCAACTTAACCCCTTGCTCTTTAATGGC
CATTTGCAGACCATATGGACAGTCACGAAGCCTAATGGGCCCAAGGTCTACTATCGACGCAAGGTCTTCGATGCC
GATCATAAAGTCTATCGCGGTACTTTTGCCGTTGACTTTGCCGTGCGTCCTTTCGAGGATCACGACGAGACACTT
CCCCGAAGAACTGTCTACTTTACTGATGAAGAGTTTGACAACATTGGCTCTACCGATAAGAGGCCCATGCTTGTT
GTTCTCCATGGCCTCTCGGGTGGCTCTCATGAAGTCTATCTTCGGCATGCCATAGCCCCCTTGCTCGAAAGCGGC
GAGTGGGAGGTTTGCGTTGTCAACTCGCGAGGATGTGCGCGTAGCAAAATTACCAGTGGCGTGCTCTACAATGCC
CGTGCCACATGGGACATTCGCCAAGTGAGACTCTTGAGCACATCCTAAAGGTGTACCCATTGCTAATCCGAGGTC
CCACGAGACTGTAAAATGGCTGCACGAGACTTTTCCCAACCGTCCCCTCTTCGGTCTTGGATTCTCTCTTGGAGC
CAATATGCTTACAAACGTGAGTCTTGTTCAGTACAGGCGCTGTATCAGACAGTTAACAGAGGACTTGTCAGTACT
GCGGCGAAGAGGGATCAAACTGCCTCTTCAAGGCGGCAATCGCCTGCTCAAACCCATTTAGCCTGGAAATATCTA
GCAAGATGCTTCAGCACAGTTTTATCGGCAGAGAAGTCTATCTTCGGGTCATGGGCAGTATGAGTCCCAATACCC
AGCTTCCTCTCCTATTGGCATTGACAGACTAACTTGGCCATGCTGTAGCCGCCATGAAAAACGTCATCAAGACTC
ATCAAAAGGAGTTGGAAAAATACTCTAATCTCGACTTGGCAGCGATAGACAAAATCACTTACTTGCAGGAATTCG
ATCGCGAGGTTCAGTACGCTATGTCTCCCCCAACCCAGTTCCAAGCAAGGCTGACGCGGTGCGGTGTAGGTGCCC
AGCTTGGGGCTATCCGACCGAATACGCTTATTATCGCGATGCCTCATCTACAGATGCTGTCATGGCAATTCGTAT
ACCCTTCATGGCTCTACAGGCCACTGACGACCCTGTTCGTAACTTCTGATAAGGCATGCTTGTTTTGAACCCATG
ATCCTGACACTTATTGCAGATTGCTGTCAATGAGGCCGTTCCTTATGCCGAGTTCCAGCAGAACCCAAGTACCGT
TCTTGTTACGACTTCTCTGGGAGGACACTTGTCCTGGTTCGAGATGGGAGGTTCCCGCTGGCACAGTCGTCCGGT
ATGACATCATCTTCCTCCTTTATTTCTGACCACTAAAGCTGACGTGGCGCGTCATAAATCGTAGCTGTGTAACTT
TTTGAATCACATGGCATTCAAAGTCGACTTGGAAAGTGTCACGCCGCTGTCTGACCCCTCAACAGCTGATGAGCT
GTCGCATGGCACCGAATATAATCCCATGCGTCGAAAATTGAATATTATCGAGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail