Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2641
Gene name
LocationContig_2:26780..27941
Strand-
Gene length (bp)1161
Transcript length (bp)1161
Coding sequence length (bp)1161
Protein length (aa) 387

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 230 386 3.0E-12
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 229 384 1.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 246 386 2.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 228 381 2.0E-11
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 220 381 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 230 386 3.0E-12
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 229 384 1.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 246 386 2.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 228 381 2.0E-11
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 220 381 2.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 228 366 2.0E-09
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 185 352 2.0E-08
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 212 382 4.0E-07
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 230 382 6.0E-07
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 274 384 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2641
MRFSTTEAIILLGCLLGSGLAATPAGKDGAPPAADDDSTDPPTENLIAGIMTGLDLSKLHLRSNGDNKVARSMMG
GSSSFERRGGGAVAIRAAVADNAQEGHDEHDYGDDWFEGGEDDGDDFFDGPPMLKKRAQTPPSRGSVKKRDGKDE
AGSEAVDAVTQQRIAALKEAMGQHMTKSMGPGSVMDDKMVVDVVEAAVASDKWAQADADEMQREQLGRTEAVAQV
ASKQQQNQTMQQQNQQQQVAQQQQQFEKMVQKQQQEQLAQQQKIQQQQIQQAQQQQDSQQQQIQQAQQQQQVQQQ
QDSQQQQQAQQQEPSQQQQQAQQQQDSQQQQQAQQQEPSQQQQQAQQQQDSQQQEPSQQQQNVQQEEEARHQQAK
QQQIEQLASKV*
Coding >OphauG2|2641
ATGAGGTTTAGTACTACTGAGGCCATCATTCTCCTGGGCTGTCTGTTGGGCAGCGGCCTGGCGGCAACACCAGCG
GGCAAAGATGGCGCGCCGCCGGCAGCTGATGATGATAGCACTGACCCGCCCACAGAGAATCTTATTGCCGGGATT
ATGACGGGGTTGGACCTGTCCAAGCTTCATCTCAGGTCTAATGGGGACAATAAGGTGGCCAGGAGCATGATGGGA
GGCTCGAGCAGCTTTGAGCGTCGAGGCGGAGGAGCCGTGGCCATTAGGGCAGCCGTAGCAGACAATGCTCAAGAG
GGACATGACGAGCATGACTACGGCGACGACTGGTTCGAGGGTGGTGAAGACGACGGAGACGACTTTTTTGACGGG
CCCCCGATGCTCAAGAAACGAGCCCAGACGCCGCCGTCGAGGGGCTCCGTCAAGAAGCGCGACGGCAAGGACGAG
GCGGGCAGCGAGGCCGTCGACGCCGTCACGCAGCAGCGCATTGCGGCTCTAAAGGAAGCCATGGGTCAGCACATG
ACCAAGTCCATGGGGCCTGGGAGCGTCATGGACGACAAGATGGTTGTTGATGTGGTGGAGGCTGCGGTGGCGAGC
GATAAGTGGGCGCAGGCCGATGCTGATGAGATGCAGAGAGAGCAGCTTGGACGGACCGAGGCGGTGGCTCAAGTG
GCTTCAAAGCAGCAGCAGAACCAAACTATGCAGCAGCAGAATCAGCAGCAGCAGGTGGCCCAGCAGCAGCAGCAG
TTTGAGAAAATGGTCCAGAAGCAGCAACAGGAACAGCTGGCTCAGCAACAAAAGATTCAGCAGCAGCAGATTCAG
CAGGCTCAGCAACAGCAAGATTCTCAGCAGCAGCAGATTCAGCAGGCTCAGCAACAGCAACAGGTTCAGCAACAG
CAAGATTCTCAGCAACAGCAACAGGCTCAGCAACAGGAGCCGTCTCAGCAACAGCAACAGGCTCAGCAACAGCAA
GATTCTCAGCAACAGCAACAGGCTCAGCAACAGGAGCCGTCTCAGCAACAGCAACAGGCTCAGCAACAGCAAGAT
TCTCAGCAACAGGAGCCGTCTCAGCAACAGCAAAATGTTCAACAAGAGGAGGAGGCTCGGCACCAGCAGGCAAAG
CAGCAGCAGATTGAACAGTTAGCCAGCAAAGTCTAG
Transcript >OphauG2|2641
ATGAGGTTTAGTACTACTGAGGCCATCATTCTCCTGGGCTGTCTGTTGGGCAGCGGCCTGGCGGCAACACCAGCG
GGCAAAGATGGCGCGCCGCCGGCAGCTGATGATGATAGCACTGACCCGCCCACAGAGAATCTTATTGCCGGGATT
ATGACGGGGTTGGACCTGTCCAAGCTTCATCTCAGGTCTAATGGGGACAATAAGGTGGCCAGGAGCATGATGGGA
GGCTCGAGCAGCTTTGAGCGTCGAGGCGGAGGAGCCGTGGCCATTAGGGCAGCCGTAGCAGACAATGCTCAAGAG
GGACATGACGAGCATGACTACGGCGACGACTGGTTCGAGGGTGGTGAAGACGACGGAGACGACTTTTTTGACGGG
CCCCCGATGCTCAAGAAACGAGCCCAGACGCCGCCGTCGAGGGGCTCCGTCAAGAAGCGCGACGGCAAGGACGAG
GCGGGCAGCGAGGCCGTCGACGCCGTCACGCAGCAGCGCATTGCGGCTCTAAAGGAAGCCATGGGTCAGCACATG
ACCAAGTCCATGGGGCCTGGGAGCGTCATGGACGACAAGATGGTTGTTGATGTGGTGGAGGCTGCGGTGGCGAGC
GATAAGTGGGCGCAGGCCGATGCTGATGAGATGCAGAGAGAGCAGCTTGGACGGACCGAGGCGGTGGCTCAAGTG
GCTTCAAAGCAGCAGCAGAACCAAACTATGCAGCAGCAGAATCAGCAGCAGCAGGTGGCCCAGCAGCAGCAGCAG
TTTGAGAAAATGGTCCAGAAGCAGCAACAGGAACAGCTGGCTCAGCAACAAAAGATTCAGCAGCAGCAGATTCAG
CAGGCTCAGCAACAGCAAGATTCTCAGCAGCAGCAGATTCAGCAGGCTCAGCAACAGCAACAGGTTCAGCAACAG
CAAGATTCTCAGCAACAGCAACAGGCTCAGCAACAGGAGCCGTCTCAGCAACAGCAACAGGCTCAGCAACAGCAA
GATTCTCAGCAACAGCAACAGGCTCAGCAACAGGAGCCGTCTCAGCAACAGCAACAGGCTCAGCAACAGCAAGAT
TCTCAGCAACAGGAGCCGTCTCAGCAACAGCAAAATGTTCAACAAGAGGAGGAGGCTCGGCACCAGCAGGCAAAG
CAGCAGCAGATTGAACAGTTAGCCAGCAAAGTCTAG
Gene >OphauG2|2641
ATGAGGTTTAGTACTACTGAGGCCATCATTCTCCTGGGCTGTCTGTTGGGCAGCGGCCTGGCGGCAACACCAGCG
GGCAAAGATGGCGCGCCGCCGGCAGCTGATGATGATAGCACTGACCCGCCCACAGAGAATCTTATTGCCGGGATT
ATGACGGGGTTGGACCTGTCCAAGCTTCATCTCAGGTCTAATGGGGACAATAAGGTGGCCAGGAGCATGATGGGA
GGCTCGAGCAGCTTTGAGCGTCGAGGCGGAGGAGCCGTGGCCATTAGGGCAGCCGTAGCAGACAATGCTCAAGAG
GGACATGACGAGCATGACTACGGCGACGACTGGTTCGAGGGTGGTGAAGACGACGGAGACGACTTTTTTGACGGG
CCCCCGATGCTCAAGAAACGAGCCCAGACGCCGCCGTCGAGGGGCTCCGTCAAGAAGCGCGACGGCAAGGACGAG
GCGGGCAGCGAGGCCGTCGACGCCGTCACGCAGCAGCGCATTGCGGCTCTAAAGGAAGCCATGGGTCAGCACATG
ACCAAGTCCATGGGGCCTGGGAGCGTCATGGACGACAAGATGGTTGTTGATGTGGTGGAGGCTGCGGTGGCGAGC
GATAAGTGGGCGCAGGCCGATGCTGATGAGATGCAGAGAGAGCAGCTTGGACGGACCGAGGCGGTGGCTCAAGTG
GCTTCAAAGCAGCAGCAGAACCAAACTATGCAGCAGCAGAATCAGCAGCAGCAGGTGGCCCAGCAGCAGCAGCAG
TTTGAGAAAATGGTCCAGAAGCAGCAACAGGAACAGCTGGCTCAGCAACAAAAGATTCAGCAGCAGCAGATTCAG
CAGGCTCAGCAACAGCAAGATTCTCAGCAGCAGCAGATTCAGCAGGCTCAGCAACAGCAACAGGTTCAGCAACAG
CAAGATTCTCAGCAACAGCAACAGGCTCAGCAACAGGAGCCGTCTCAGCAACAGCAACAGGCTCAGCAACAGCAA
GATTCTCAGCAACAGCAACAGGCTCAGCAACAGGAGCCGTCTCAGCAACAGCAACAGGCTCAGCAACAGCAAGAT
TCTCAGCAACAGGAGCCGTCTCAGCAACAGCAAAATGTTCAACAAGAGGAGGAGGCTCGGCACCAGCAGGCAAAG
CAGCAGCAGATTGAACAGTTAGCCAGCAAAGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail