Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2586
Gene name
LocationContig_1966:112..1498
Strand-
Gene length (bp)1386
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01866 Diphthamide_syn Putative diphthamide synthesis protein 1.2E-79 1 316

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I5M4|DPH2_GIBZE Diphthamide biosynthesis protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH2 PE=3 SV=1 1 329 3.0E-140
sp|Q7S5C0|DPH2_NEUCR Diphthamide biosynthesis protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-2 PE=3 SV=1 29 329 1.0E-116
sp|Q5B2Q1|DPH2_EMENI Diphthamide biosynthesis protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph2 PE=3 SV=1 17 315 5.0E-93
sp|Q4WN99|DPH2_ASPFU Diphthamide biosynthesis protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph2 PE=3 SV=1 21 315 7.0E-89
sp|Q6FPD9|DPH2_CANGA Diphthamide biosynthesis protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPH2 PE=3 SV=1 1 315 2.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I5M4|DPH2_GIBZE Diphthamide biosynthesis protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH2 PE=3 SV=1 1 329 3.0E-140
sp|Q7S5C0|DPH2_NEUCR Diphthamide biosynthesis protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-2 PE=3 SV=1 29 329 1.0E-116
sp|Q5B2Q1|DPH2_EMENI Diphthamide biosynthesis protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph2 PE=3 SV=1 17 315 5.0E-93
sp|Q4WN99|DPH2_ASPFU Diphthamide biosynthesis protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph2 PE=3 SV=1 21 315 7.0E-89
sp|Q6FPD9|DPH2_CANGA Diphthamide biosynthesis protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPH2 PE=3 SV=1 1 315 2.0E-55
sp|Q10206|DPH2_SCHPO Diphthamide biosynthesis protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph2 PE=3 SV=1 27 329 3.0E-55
sp|P32461|DPH2_YEAST Diphthamide biosynthesis protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPH2 PE=1 SV=1 32 315 7.0E-53
sp|Q59SJ9|DPH2_CANAL Diphthamide biosynthesis protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPH2 PE=3 SV=1 1 315 3.0E-50
sp|A4QN59|DPH2_DANRE Diphthamide biosynthesis protein 2 OS=Danio rerio GN=dph2 PE=2 SV=1 8 315 1.0E-49
sp|Q6CS90|DPH2_KLULA Diphthamide biosynthesis protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPH2 PE=3 SV=1 23 315 3.0E-49
sp|Q757B6|DPH2_ASHGO Diphthamide biosynthesis protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH2 PE=3 SV=1 20 315 3.0E-48
sp|Q5ZKI2|DPH2_CHICK Diphthamide biosynthesis protein 2 OS=Gallus gallus GN=DPH2 PE=2 SV=1 30 315 3.0E-47
sp|Q6BMF6|DPH2_DEBHA Diphthamide biosynthesis protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPH2 PE=3 SV=2 29 330 3.0E-46
sp|Q6DE00|DPH2_XENLA Diphthamide biosynthesis protein 2 OS=Xenopus laevis GN=dph2 PE=2 SV=1 29 311 1.0E-45
sp|A7SKJ3|DPH2_NEMVE Diphthamide biosynthesis protein 2 OS=Nematostella vectensis GN=dph2 PE=3 SV=1 30 317 7.0E-44
sp|Q6CGE7|DPH2_YARLI Diphthamide biosynthesis protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH2 PE=3 SV=1 9 325 2.0E-39
sp|P0CN20|DPH2_CRYNJ Diphthamide biosynthesis protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DPH2 PE=3 SV=1 31 316 2.0E-37
sp|P0CN21|DPH2_CRYNB Diphthamide biosynthesis protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DPH2 PE=3 SV=1 31 316 2.0E-37
sp|Q568Y2|DPH2_RAT Diphthamide biosynthesis protein 2 OS=Rattus norvegicus GN=Dph2 PE=2 SV=1 29 302 4.0E-29
sp|Q9CR25|DPH2_MOUSE Diphthamide biosynthesis protein 2 OS=Mus musculus GN=Dph2 PE=1 SV=1 29 302 1.0E-27
sp|Q002B5|DPH2_CRIGR Diphthamide biosynthesis protein 2 OS=Cricetulus griseus GN=DPH2 PE=2 SV=1 29 302 6.0E-27
sp|Q5RE82|DPH2_PONAB Diphthamide biosynthesis protein 2 OS=Pongo abelii GN=DPH2 PE=2 SV=1 29 302 4.0E-26
sp|Q9BQC3|DPH2_HUMAN Diphthamide biosynthesis protein 2 OS=Homo sapiens GN=DPH2 PE=1 SV=1 29 302 7.0E-25
sp|Q08DM2|DPH2_BOVIN Diphthamide biosynthesis protein 2 OS=Bos taurus GN=DPH2 PE=2 SV=1 29 302 1.0E-23
sp|Q09454|DPH2_CAEEL Diphthamide biosynthesis protein 2 OS=Caenorhabditis elegans GN=dph-2 PE=3 SV=2 8 315 3.0E-22
sp|Q3T7C9|DPH1_LITVA Diphthamide biosynthesis protein 1 OS=Litopenaeus vannamei PE=1 SV=1 3 303 6.0E-22
sp|B0G132|DPH2_DICDI Diphthamide biosynthesis protein 2 OS=Dictyostelium discoideum GN=dph2 PE=3 SV=1 172 315 2.0E-21
sp|Q6CLC9|DPH1_KLULA Diphthamide biosynthesis protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPH1 PE=3 SV=1 17 316 5.0E-15
sp|B0G132|DPH2_DICDI Diphthamide biosynthesis protein 2 OS=Dictyostelium discoideum GN=dph2 PE=3 SV=1 8 120 8.0E-15
sp|Q54PW5|DPH1_DICDI Diphthamide biosynthesis protein 1 OS=Dictyostelium discoideum GN=dph1 PE=3 SV=1 32 303 3.0E-14
sp|Q6C0S8|DPH1_YARLI Diphthamide biosynthesis protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH1 PE=3 SV=1 32 317 2.0E-13
sp|Q6BPU5|DPH1_DEBHA Diphthamide biosynthesis protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPH1 PE=3 SV=2 17 316 1.0E-12
sp|Q6FTG1|DPH1_CANGA Diphthamide biosynthesis protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPH1 PE=3 SV=1 32 316 2.0E-12
sp|Q75AZ9|DPH1_ASHGO Diphthamide biosynthesis protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH1 PE=3 SV=1 32 316 4.0E-12
sp|O59713|DPH1_SCHPO Diphthamide biosynthesis protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 32 303 5.0E-12
sp|P40487|DPH1_YEAST Diphthamide biosynthesis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPH1 PE=1 SV=1 32 306 1.0E-11
sp|Q6GPQ5|DPH1_XENLA Diphthamide biosynthesis protein 1 OS=Xenopus laevis GN=dph1 PE=2 SV=2 3 303 4.0E-11
sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph1 PE=3 SV=1 32 303 5.0E-11
sp|Q59MG1|DPH1_CANAL Diphthamide biosynthesis protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPH1 PE=3 SV=2 32 307 1.0E-10
sp|Q7SC98|DPH1_NEUCR Diphthamide biosynthesis protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-1 PE=3 SV=1 4 313 2.0E-10
sp|Q9BZG8|DPH1_HUMAN Diphthamide biosynthesis protein 1 OS=Homo sapiens GN=DPH1 PE=1 SV=2 3 303 1.0E-09
sp|Q5AZJ7|DPH1_EMENI Diphthamide biosynthesis protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph1 PE=3 SV=2 32 303 2.0E-09
sp|Q3SYT1|DPH1_BOVIN Diphthamide biosynthesis protein 1 OS=Bos taurus GN=DPH1 PE=2 SV=1 3 303 3.0E-09
sp|Q4IQ72|DPH1_GIBZE Diphthamide biosynthesis protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH1 PE=3 SV=1 32 312 3.0E-08
sp|Q5ZHX9|DPH1_CHICK Diphthamide biosynthesis protein 1 OS=Gallus gallus GN=DPH1 PE=2 SV=1 3 303 2.0E-07
sp|Q4I5M4|DPH2_GIBZE Diphthamide biosynthesis protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH2 PE=3 SV=1 418 461 4.0E-07
sp|Q567W6|DPH1_DANRE Diphthamide biosynthesis protein 1 OS=Danio rerio GN=dph1 PE=2 SV=1 32 312 2.0E-06
sp|P0CN18|DPH1_CRYNJ Diphthamide biosynthesis protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DPH1 PE=3 SV=1 32 95 2.0E-06
sp|P0CN19|DPH1_CRYNB Diphthamide biosynthesis protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DPH1 PE=3 SV=1 32 95 2.0E-06
sp|O58832|DPH2_PYRHO 2-(3-amino-3-carboxypropyl)histidine synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=dph2 PE=1 SV=1 10 303 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0017183 peptidyl-diphthamide biosynthetic process from peptidyl-histidine Yes
GO:0090560 2-(3-amino-3-carboxypropyl)histidine synthase activity Yes
GO:0050789 regulation of biological process No
GO:0043412 macromolecule modification No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0008152 metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0080090 regulation of primary metabolic process No
GO:0006448 regulation of translational elongation No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0009889 regulation of biosynthetic process No
GO:0017182 peptidyl-diphthamide metabolic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:1900247 regulation of cytoplasmic translational elongation No
GO:0019222 regulation of metabolic process No
GO:0018202 peptidyl-histidine modification No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0018193 peptidyl-amino acid modification No
GO:0003674 molecular_function No
GO:0031326 regulation of cellular biosynthetic process No
GO:0034248 regulation of cellular amide metabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006417 regulation of translation No
GO:0051246 regulation of protein metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0016740 transferase activity No
GO:0044249 cellular biosynthetic process No
GO:0010608 post-transcriptional regulation of gene expression No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0065007 biological regulation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2586
MLADAPHVAQTMRDELLALSDAKQDAEPRIHILADTSYSACCVDEIAAEHVDADVVVHYGRTCLSPTSRLPVIHV
YTRHQLDMEAAVTRIASAFPDCETKVVVMADLTLQHHVADLVERLQALGYTHVLGTEAVRDPTAVVPNRRIVGVQ
SLEATACKEYVLLHLSEPAPALLLALYSRFASLHVVDTSCASLQDATAQTGALLRRRYARVLSLASAGVIGILVN
TLSVCNYLESIDTLRTLISRAGKKSYTVVVGKLNPAKLANLAEIEAWVSVGCWESGLVAEDASYWRPVATPFELQ
VALMSETARTWGSEWWGGTEKLQLTTEEQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNKRTWQGLGSDFGAVDEASRSTAVEEGRSGIA
RGYVVGNGERH*
Coding >OphauG2|2586
ATGCTGGCTGACGCGCCGCATGTTGCGCAGACCATGCGTGACGAGCTGCTCGCCTTGTCCGACGCCAAACAAGAC
GCAGAGCCGCGCATTCACATCTTGGCGGATACGAGCTACAGTGCGTGCTGTGTCGACGAAATTGCGGCCGAGCAC
GTCGACGCCGACGTGGTGGTGCACTATGGGCGCACCTGTCTGAGCCCCACCAGTCGGCTGCCCGTCATACACGTC
TATACGCGGCATCAGCTCGACATGGAAGCTGCCGTGACGCGCATTGCGTCTGCGTTTCCCGATTGCGAGACCAAG
GTGGTGGTCATGGCCGACTTGACGCTTCAGCACCATGTCGCGGACTTGGTGGAGCGGCTACAGGCGCTGGGATAC
ACACATGTCCTGGGGACCGAGGCTGTGCGGGATCCGACTGCAGTTGTGCCAAACCGCCGAATCGTCGGAGTGCAG
AGTCTCGAGGCCACGGCCTGCAAGGAGTATGTGCTGCTGCACCTGTCGGAGCCAGCGCCGGCGCTCCTGCTGGCG
CTATACTCGCGCTTCGCGTCGCTGCACGTGGTCGACACGTCTTGCGCGTCTCTGCAAGACGCAACAGCCCAGACG
GGTGCGCTGCTTAGACGGCGCTACGCCCGCGTGCTGTCGCTTGCATCGGCGGGTGTGATTGGCATCCTGGTGAAC
ACGCTCTCGGTATGCAATTACCTGGAATCGATTGACACGCTGCGCACTCTGATATCACGTGCGGGGAAAAAGAGC
TATACGGTTGTGGTGGGCAAGCTGAATCCGGCAAAGCTGGCGAATCTGGCCGAGATTGAGGCATGGGTGTCGGTC
GGGTGCTGGGAGAGCGGGCTGGTGGCCGAGGACGCGTCGTATTGGCGGCCGGTGGCGACGCCGTTTGAGCTCCAG
GTGGCGCTGATGAGCGAGACGGCCCGGACTTGGGGCTCGGAGTGGTGGGGAGGGACTGAGAAGCTGCAGCTGACG
ACGGAGGAGCAGCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCGAAACAAGCGGACGTGGCAGGGG
CTGGGAAGCGACTTTGGGGCGGTGGATGAGGCGAGCAGGAGCACGGCTGTGGAGGAGGGGCGGAGCGGGATAGCG
AGGGGGTACGTGGTTGGCAACGGGGAGAGGCACTAA
Transcript >OphauG2|2586
ATGCTGGCTGACGCGCCGCATGTTGCGCAGACCATGCGTGACGAGCTGCTCGCCTTGTCCGACGCCAAACAAGAC
GCAGAGCCGCGCATTCACATCTTGGCGGATACGAGCTACAGTGCGTGCTGTGTCGACGAAATTGCGGCCGAGCAC
GTCGACGCCGACGTGGTGGTGCACTATGGGCGCACCTGTCTGAGCCCCACCAGTCGGCTGCCCGTCATACACGTC
TATACGCGGCATCAGCTCGACATGGAAGCTGCCGTGACGCGCATTGCGTCTGCGTTTCCCGATTGCGAGACCAAG
GTGGTGGTCATGGCCGACTTGACGCTTCAGCACCATGTCGCGGACTTGGTGGAGCGGCTACAGGCGCTGGGATAC
ACACATGTCCTGGGGACCGAGGCTGTGCGGGATCCGACTGCAGTTGTGCCAAACCGCCGAATCGTCGGAGTGCAG
AGTCTCGAGGCCACGGCCTGCAAGGAGTATGTGCTGCTGCACCTGTCGGAGCCAGCGCCGGCGCTCCTGCTGGCG
CTATACTCGCGCTTCGCGTCGCTGCACGTGGTCGACACGTCTTGCGCGTCTCTGCAAGACGCAACAGCCCAGACG
GGTGCGCTGCTTAGACGGCGCTACGCCCGCGTGCTGTCGCTTGCATCGGCGGGTGTGATTGGCATCCTGGTGAAC
ACGCTCTCGGTATGCAATTACCTGGAATCGATTGACACGCTGCGCACTCTGATATCACGTGCGGGGAAAAAGAGC
TATACGGTTGTGGTGGGCAAGCTGAATCCGGCAAAGCTGGCGAATCTGGCCGAGATTGAGGCATGGGTGTCGGTC
GGGTGCTGGGAGAGCGGGCTGGTGGCCGAGGACGCGTCGTATTGGCGGCCGGTGGCGACGCCGTTTGAGCTCCAG
GTGGCGCTGATGAGCGAGACGGCCCGGACTTGGGGCTCGGAGTGGTGGGGAGGGACTGAGAAGCTGCAGCTGACG
ACGGAGGAGCAGCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCGAAACAAGCGGACGTGGCAGGGG
CTGGGAAGCGACTTTGGGGCGGTGGATGAGGCGAGCAGGAGCACGGCTGTGGAGGAGGGGCGGAGCGGGATAGCG
AGGGGGTACGTGGTTGGCAACGGGGAGAGGCACTAA
Gene >OphauG2|2586
ATGCTGGCTGACGCGCCGCATGTTGCGCAGACCATGCGTGACGAGCTGCTCGCCTTGTCCGACGCCAAACAAGAC
GCAGAGCCGCGCATTCACATCTTGGCGGATACGAGCTACAGTGCGTGCTGTGTCGACGAAATTGCGGCCGAGCAC
GTCGACGCCGACGTGGTGGTGCACTATGGGCGCACCTGTCTGAGCCCCACCAGTCGGCTGCCCGTCATACACGTC
TATACGCGGCATCAGCTCGACATGGAAGCTGCCGTGACGCGCATTGCGTCTGCGTTTCCCGATTGCGAGACCAAG
GTGGTGGTCATGGCCGACTTGACGCTTCAGCACCATGTCGCGGACTTGGTGGAGCGGCTACAGGCGCTGGGATAC
ACACATGTCCTGGGGACCGAGGCTGTGCGGGATCCGACTGCAGTTGTGCCAAACCGCCGAATCGTCGGAGTGCAG
AGTCTCGAGGCCACGGCCTGCAAGGAGTATGTGCTGCTGCACCTGTCGGAGCCAGCGCCGGCGCTCCTGCTGGCG
CTATACTCGCGCTTCGCGTCGCTGCACGTGGTCGACACGTCTTGCGCGTCTCTGCAAGACGCAACAGCCCAGACG
GGTGCGCTGCTTAGACGGCGCTACGCCCGCGTGCTGTCGCTTGCATCGGCGGGTGTGATTGGCATCCTGGTGAAC
ACGCTCTCGGTATGCAATTACCTGGAATCGATTGACACGCTGCGCACTCTGATATCACGTGCGGGGAAAAAGAGC
TATACGGTTGTGGTGGGCAAGCTGAATCCGGCAAAGCTGGCGAATCTGGCCGAGATTGAGGCATGGGTGTCGGTC
GGGTGCTGGGAGAGCGGGCTGGTGGCCGAGGACGCGTCGTATTGGCGGCCGGTGGCGACGCCGTTTGAGCTCCAG
GTGGCGCTGATGAGCGAGACGGCCCGGACTTGGGGCTCGGAGTGGTGGGGAGGGACTGAGAAGCTGCAGCTGACG
ACGGAGGAGCAGCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCGAAACAAGCGGACGTGGCAGGGG
CTGGGAAGCGACTTTGGGGCGGTGGATGAGGCGAGCAGGAGCACGGCTGTGGAGGAGGGGCGGAGCGGGATAGCG
AGGGGGTACGTGGTTGGCAACGGGGAGAGGCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail