Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2557
Gene name
LocationContig_1949:36..594
Strand+
Gene length (bp)558
Transcript length (bp)558
Coding sequence length (bp)558
Protein length (aa) 186

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family 3.7E-25 24 182

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup899
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2529
Ophiocordyceps australis 1348a (Ghana) OphauG2|2557 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|3148
Ophiocordyceps australis map64 (Brazil) OphauB2|1785
Ophiocordyceps australis map64 (Brazil) OphauB2|985
Ophiocordyceps australis map64 (Brazil) OphauB2|986
Ophiocordyceps camponoti-rufipedis Ophun1|7329
Ophiocordyceps subramaniannii Hirsu2|5853

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2557
MPFHYDGLFKTAPQVNAAGETVMVSTPPRFQFFTAPTASPRTTGFTLFSSSTQVFGHLPPWLSADNLADKTWSVC
TESFGSSKLGGLPLISRHPETGQPCLRYHEPWPQTKTRFDATSVTIDGVSETESRAICDAIDAVLHDRRVAYYHS
WEKGDVVVSDNVLMMHTRSDFTAGSDRELWRIHFD*
Coding >OphauG2|2557
ATGCCCTTTCACTACGACGGGCTGTTCAAGACGGCGCCGCAGGTCAATGCCGCCGGGGAAACAGTCATGGTGTCG
ACGCCGCCGCGCTTCCAGTTCTTCACGGCGCCCACCGCCTCGCCCAGGACAACGGGCTTTACCCTGTTTTCCTCG
TCGACGCAGGTCTTTGGCCATTTGCCGCCCTGGCTGAGCGCCGACAACCTGGCCGACAAGACGTGGAGCGTGTGC
ACCGAGTCCTTTGGCAGCAGTAAGCTGGGCGGCCTGCCTCTGATTAGCCGCCATCCCGAGACTGGGCAGCCGTGT
CTTCGCTACCATGAGCCCTGGCCGCAGACAAAGACGCGGTTCGACGCGACGAGCGTCACGATTGACGGCGTCAGC
GAGACGGAGAGCAGGGCCATCTGCGACGCCATTGACGCCGTGCTGCATGATAGACGGGTGGCGTATTATCACTCG
TGGGAAAAGGGCGATGTGGTGGTGAGTGATAATGTCCTCATGATGCATACCCGCAGCGACTTTACCGCCGGCAGC
GATCGCGAGCTGTGGCGCATTCACTTTGATTAG
Transcript >OphauG2|2557
ATGCCCTTTCACTACGACGGGCTGTTCAAGACGGCGCCGCAGGTCAATGCCGCCGGGGAAACAGTCATGGTGTCG
ACGCCGCCGCGCTTCCAGTTCTTCACGGCGCCCACCGCCTCGCCCAGGACAACGGGCTTTACCCTGTTTTCCTCG
TCGACGCAGGTCTTTGGCCATTTGCCGCCCTGGCTGAGCGCCGACAACCTGGCCGACAAGACGTGGAGCGTGTGC
ACCGAGTCCTTTGGCAGCAGTAAGCTGGGCGGCCTGCCTCTGATTAGCCGCCATCCCGAGACTGGGCAGCCGTGT
CTTCGCTACCATGAGCCCTGGCCGCAGACAAAGACGCGGTTCGACGCGACGAGCGTCACGATTGACGGCGTCAGC
GAGACGGAGAGCAGGGCCATCTGCGACGCCATTGACGCCGTGCTGCATGATAGACGGGTGGCGTATTATCACTCG
TGGGAAAAGGGCGATGTGGTGGTGAGTGATAATGTCCTCATGATGCATACCCGCAGCGACTTTACCGCCGGCAGC
GATCGCGAGCTGTGGCGCATTCACTTTGATTAG
Gene >OphauG2|2557
ATGCCCTTTCACTACGACGGGCTGTTCAAGACGGCGCCGCAGGTCAATGCCGCCGGGGAAACAGTCATGGTGTCG
ACGCCGCCGCGCTTCCAGTTCTTCACGGCGCCCACCGCCTCGCCCAGGACAACGGGCTTTACCCTGTTTTCCTCG
TCGACGCAGGTCTTTGGCCATTTGCCGCCCTGGCTGAGCGCCGACAACCTGGCCGACAAGACGTGGAGCGTGTGC
ACCGAGTCCTTTGGCAGCAGTAAGCTGGGCGGCCTGCCTCTGATTAGCCGCCATCCCGAGACTGGGCAGCCGTGT
CTTCGCTACCATGAGCCCTGGCCGCAGACAAAGACGCGGTTCGACGCGACGAGCGTCACGATTGACGGCGTCAGC
GAGACGGAGAGCAGGGCCATCTGCGACGCCATTGACGCCGTGCTGCATGATAGACGGGTGGCGTATTATCACTCG
TGGGAAAAGGGCGATGTGGTGGTGAGTGATAATGTCCTCATGATGCATACCCGCAGCGACTTTACCGCCGGCAGC
GATCGCGAGCTGTGGCGCATTCACTTTGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail