Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2552
Gene name
LocationContig_1944:192..1536
Strand-
Gene length (bp)1344
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase 1.5E-24 75 242

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1RMN6|TAL_SHESW Transaldolase OS=Shewanella sp. (strain W3-18-1) GN=tal PE=3 SV=1 12 241 9.0E-15
sp|A4Y494|TAL_SHEPC Transaldolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tal PE=3 SV=1 12 241 9.0E-15
sp|A3QBW2|TAL_SHELP Transaldolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tal PE=3 SV=1 12 242 2.0E-14
sp|A1S414|TAL_SHEAM Transaldolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tal PE=3 SV=1 12 242 3.0E-14
sp|C5CPN2|TAL_VARPS Transaldolase OS=Variovorax paradoxus (strain S110) GN=tal PE=3 SV=1 12 305 9.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1RMN6|TAL_SHESW Transaldolase OS=Shewanella sp. (strain W3-18-1) GN=tal PE=3 SV=1 12 241 9.0E-15
sp|A4Y494|TAL_SHEPC Transaldolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tal PE=3 SV=1 12 241 9.0E-15
sp|A3QBW2|TAL_SHELP Transaldolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tal PE=3 SV=1 12 242 2.0E-14
sp|A1S414|TAL_SHEAM Transaldolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tal PE=3 SV=1 12 242 3.0E-14
sp|C5CPN2|TAL_VARPS Transaldolase OS=Variovorax paradoxus (strain S110) GN=tal PE=3 SV=1 12 305 9.0E-14
sp|Q8EBH2|TAL_SHEON Transaldolase OS=Shewanella oneidensis (strain MR-1) GN=tal PE=3 SV=1 12 240 1.0E-13
sp|Q0HS72|TAL_SHESR Transaldolase OS=Shewanella sp. (strain MR-7) GN=tal PE=3 SV=1 12 240 1.0E-13
sp|Q07Z25|TAL_SHEFN Transaldolase OS=Shewanella frigidimarina (strain NCIMB 400) GN=tal PE=3 SV=1 48 239 1.0E-13
sp|Q0HFX9|TAL_SHESM Transaldolase OS=Shewanella sp. (strain MR-4) GN=tal PE=3 SV=1 12 240 1.0E-13
sp|A8H1G4|TAL_SHEPA Transaldolase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tal PE=3 SV=1 48 242 2.0E-13
sp|A0L002|TAL_SHESA Transaldolase OS=Shewanella sp. (strain ANA-3) GN=tal PE=3 SV=1 73 240 3.0E-13
sp|B8EFD7|TAL_SHEB2 Transaldolase OS=Shewanella baltica (strain OS223) GN=tal PE=3 SV=1 56 240 4.0E-13
sp|A6WKC4|TAL_SHEB8 Transaldolase OS=Shewanella baltica (strain OS185) GN=tal PE=3 SV=1 56 240 4.0E-13
sp|A8FSH3|TAL_SHESH Transaldolase OS=Shewanella sediminis (strain HAW-EB3) GN=tal PE=3 SV=1 12 240 5.0E-13
sp|A9L4T6|TAL_SHEB9 Transaldolase OS=Shewanella baltica (strain OS195) GN=tal PE=3 SV=1 56 240 5.0E-13
sp|A3D1F5|TAL_SHEB5 Transaldolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tal PE=3 SV=1 56 240 6.0E-13
sp|O42700|TAL1_SCHPO Transaldolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tal1 PE=1 SV=2 48 295 8.0E-13
sp|B8F5Q3|TAL_HAEPS Transaldolase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=tal PE=3 SV=1 12 242 8.0E-13
sp|B8CSD3|TAL_SHEPW Transaldolase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=tal PE=3 SV=1 75 242 1.0E-12
sp|Q7N8Z1|TAL_PHOLL Transaldolase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tal PE=3 SV=1 79 254 1.0E-12
sp|Q12KL3|TAL_SHEDO Transaldolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tal PE=3 SV=1 12 239 2.0E-12
sp|B1KIS4|TAL_SHEWM Transaldolase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tal PE=3 SV=1 12 240 2.0E-12
sp|Q15PR4|TAL_PSEA6 Transaldolase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tal PE=3 SV=1 74 242 2.0E-12
sp|Q9PK80|TAL_CHLMU Transaldolase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tal PE=3 SV=1 85 242 3.0E-12
sp|Q9I047|TAL_PSEAE Transaldolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tal PE=3 SV=1 70 241 3.0E-12
sp|Q02NV3|TAL_PSEAB Transaldolase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tal PE=3 SV=1 70 241 3.0E-12
sp|B7UWP0|TAL_PSEA8 Transaldolase OS=Pseudomonas aeruginosa (strain LESB58) GN=tal PE=3 SV=1 70 241 3.0E-12
sp|B0TJA0|TAL_SHEHH Transaldolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tal PE=3 SV=1 12 242 5.0E-12
sp|A1TKQ3|TAL_ACIAC Transaldolase OS=Acidovorax citrulli (strain AAC00-1) GN=tal PE=3 SV=1 51 242 6.0E-12
sp|A1JJD0|TAL_YERE8 Transaldolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tal PE=3 SV=1 72 254 6.0E-12
sp|Q7NK81|TAL_GLOVI Transaldolase OS=Gloeobacter violaceus (strain PCC 7421) GN=tal PE=3 SV=1 10 241 7.0E-12
sp|P66955|TALB_SALTY Transaldolase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=talB PE=3 SV=2 79 265 1.0E-11
sp|P66956|TALB_SALTI Transaldolase B OS=Salmonella typhi GN=talB PE=3 SV=2 79 265 1.0E-11
sp|Q5PDM6|TAL1_SALPA Transaldolase 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tal1 PE=3 SV=1 79 265 1.0E-11
sp|Q57TP8|TAL1_SALCH Transaldolase 1 OS=Salmonella choleraesuis (strain SC-B67) GN=tal1 PE=3 SV=2 79 265 1.0E-11
sp|Q5N127|TAL_SYNP6 Transaldolase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=tal PE=3 SV=1 48 241 1.0E-11
sp|A9R021|TAL_YERPG Transaldolase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tal PE=3 SV=1 79 254 1.0E-11
sp|Q8ZIN2|TAL_YERPE Transaldolase OS=Yersinia pestis GN=tal PE=3 SV=1 79 254 1.0E-11
sp|A7FME9|TAL_YERP3 Transaldolase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tal PE=3 SV=1 79 254 1.0E-11
sp|B1JL09|TAL_YERPY Transaldolase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tal PE=3 SV=1 79 254 1.0E-11
sp|Q66ET5|TAL_YERPS Transaldolase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tal PE=3 SV=1 79 254 1.0E-11
sp|B2K3L5|TAL_YERPB Transaldolase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tal PE=3 SV=1 79 254 1.0E-11
sp|A1W3W5|TAL_ACISJ Transaldolase OS=Acidovorax sp. (strain JS42) GN=tal PE=3 SV=1 12 242 1.0E-11
sp|Q9CKH9|TALB_PASMU Transaldolase B OS=Pasteurella multocida (strain Pm70) GN=talB PE=3 SV=1 12 236 2.0E-11
sp|P34214|TAL1_KLULA Transaldolase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TAL1 PE=3 SV=3 70 296 2.0E-11
sp|Q1H0R4|TAL_METFK Transaldolase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tal PE=3 SV=1 10 241 2.0E-11
sp|Q8DLL7|TAL_THEEB Transaldolase OS=Thermosynechococcus elongatus (strain BP-1) GN=tal PE=3 SV=1 9 239 2.0E-11
sp|B9MDC2|TAL_ACIET Transaldolase OS=Acidovorax ebreus (strain TPSY) GN=tal PE=3 SV=1 12 242 3.0E-11
sp|C1F2H6|TAL_ACIC5 Transaldolase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=tal PE=3 SV=1 65 241 3.0E-11
sp|Q326L3|TAL_SHIBS Transaldolase OS=Shigella boydii serotype 4 (strain Sb227) GN=tal PE=3 SV=1 79 254 3.0E-11
sp|K0BE10|TAL_ECO1E Transaldolase OS=Escherichia coli O104:H4 (strain 2009EL-2071) GN=tal PE=1 SV=1 79 254 3.0E-11
sp|Q32KB0|TAL_SHIDS Transaldolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tal PE=3 SV=1 79 254 3.0E-11
sp|P0A872|TALB_SHIFL Transaldolase B OS=Shigella flexneri GN=talB PE=3 SV=2 79 254 3.0E-11
sp|P0A870|TALB_ECOLI Transaldolase B OS=Escherichia coli (strain K12) GN=talB PE=1 SV=2 79 254 3.0E-11
sp|Q8FLD1|TALB_ECOL6 Transaldolase B OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=talB PE=3 SV=3 79 254 3.0E-11
sp|P0A871|TALB_ECO57 Transaldolase B OS=Escherichia coli O157:H7 GN=talB PE=3 SV=2 79 254 3.0E-11
sp|Q3Z606|TAL1_SHISS Transaldolase 1 OS=Shigella sonnei (strain Ss046) GN=tal1 PE=3 SV=1 79 254 3.0E-11
sp|A4SK74|TAL_AERS4 Transaldolase OS=Aeromonas salmonicida (strain A449) GN=tal PE=3 SV=1 48 241 3.0E-11
sp|Q7V6B8|TAL_PROMM Transaldolase OS=Prochlorococcus marinus (strain MIT 9313) GN=tal PE=3 SV=1 10 279 4.0E-11
sp|A4VK43|TAL_PSEU5 Transaldolase OS=Pseudomonas stutzeri (strain A1501) GN=tal PE=3 SV=1 76 237 4.0E-11
sp|C5B7L0|TAL_EDWI9 Transaldolase OS=Edwardsiella ictaluri (strain 93-146) GN=tal PE=3 SV=1 79 239 4.0E-11
sp|Q3KM49|TAL_CHLTA Transaldolase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tal PE=3 SV=1 85 242 5.0E-11
sp|O84315|TAL_CHLTR Transaldolase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tal PE=3 SV=1 85 242 5.0E-11
sp|A2C0X8|TAL_PROM1 Transaldolase OS=Prochlorococcus marinus (strain NATL1A) GN=tal PE=3 SV=1 10 240 6.0E-11
sp|P53228|TAL2_YEAST Transaldolase NQM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NQM1 PE=1 SV=1 36 296 6.0E-11
sp|B4F2V2|TAL_PROMH Transaldolase OS=Proteus mirabilis (strain HI4320) GN=tal PE=3 SV=1 48 254 7.0E-11
sp|B0BRM0|TAL_ACTPJ Transaldolase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=tal PE=3 SV=1 9 242 9.0E-11
sp|Q4ZV64|TAL_PSEU2 Transaldolase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tal PE=3 SV=1 9 307 9.0E-11
sp|Q9CKL0|TALA_PASMU Transaldolase A OS=Pasteurella multocida (strain Pm70) GN=talA PE=3 SV=1 12 254 1.0E-10
sp|B3GZQ2|TAL_ACTP7 Transaldolase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=tal PE=3 SV=1 9 242 2.0E-10
sp|A1U1Y1|TAL_MARHV Transaldolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=tal PE=3 SV=1 10 236 2.0E-10
sp|Q4KF90|TAL_PSEF5 Transaldolase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tal PE=3 SV=1 80 238 2.0E-10
sp|Q9Z998|TAL_CHLPN Transaldolase OS=Chlamydia pneumoniae GN=tal PE=3 SV=1 85 242 3.0E-10
sp|C4K4G2|TAL_HAMD5 Transaldolase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tal PE=3 SV=1 72 253 3.0E-10
sp|B4RX40|TAL_ALTMD Transaldolase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tal PE=3 SV=1 81 238 3.0E-10
sp|Q884H4|TAL_PSESM Transaldolase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tal PE=3 SV=1 70 237 4.0E-10
sp|Q48KH5|TAL_PSE14 Transaldolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tal PE=3 SV=1 9 237 4.0E-10
sp|Q7VD64|TAL_PROMA Transaldolase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tal PE=3 SV=1 10 241 4.0E-10
sp|A3MYD4|TAL_ACTP2 Transaldolase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=tal PE=3 SV=1 9 242 4.0E-10
sp|Q2TBL6|TALDO_BOVIN Transaldolase OS=Bos taurus GN=TALDO1 PE=2 SV=1 55 263 5.0E-10
sp|A2BVI1|TAL_PROM5 Transaldolase OS=Prochlorococcus marinus (strain MIT 9515) GN=tal PE=3 SV=1 10 237 5.0E-10
sp|B2U9W5|TAL_RALPJ Transaldolase OS=Ralstonia pickettii (strain 12J) GN=tal PE=3 SV=1 12 242 5.0E-10
sp|A1WIS6|TAL_VEREI Transaldolase OS=Verminephrobacter eiseniae (strain EF01-2) GN=tal PE=3 SV=1 84 249 6.0E-10
sp|Q46GQ7|TAL_PROMT Transaldolase OS=Prochlorococcus marinus (strain NATL2A) GN=tal PE=3 SV=1 10 240 8.0E-10
sp|A6V3U3|TAL_PSEA7 Transaldolase OS=Pseudomonas aeruginosa (strain PA7) GN=tal PE=3 SV=1 70 241 1.0E-09
sp|Q54UP4|TALDO_DICDI Probable transaldolase OS=Dictyostelium discoideum GN=tal PE=3 SV=1 12 241 1.0E-09
sp|P72797|TAL_SYNY3 Transaldolase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=tal PE=3 SV=1 78 241 2.0E-09
sp|Q602L8|TAL_METCA Transaldolase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tal PE=3 SV=1 10 241 2.0E-09
sp|A3PBP3|TAL_PROM0 Transaldolase OS=Prochlorococcus marinus (strain MIT 9301) GN=tal PE=3 SV=1 10 236 3.0E-09
sp|Q31C15|TAL_PROM9 Transaldolase OS=Prochlorococcus marinus (strain MIT 9312) GN=tal PE=1 SV=1 10 236 3.0E-09
sp|Q8Y014|TAL_RALSO Transaldolase OS=Ralstonia solanacearum (strain GMI1000) GN=tal PE=3 SV=1 12 242 3.0E-09
sp|A9BEE2|TAL_PROM4 Transaldolase OS=Prochlorococcus marinus (strain MIT 9211) GN=tal PE=3 SV=1 55 242 3.0E-09
sp|Q8Z4T0|TALA_SALTI Transaldolase A OS=Salmonella typhi GN=talA PE=3 SV=1 66 228 3.0E-09
sp|Q57LN7|TAL2_SALCH Transaldolase 2 OS=Salmonella choleraesuis (strain SC-B67) GN=tal2 PE=3 SV=1 66 228 3.0E-09
sp|B6ERE2|TAL_ALISL Transaldolase OS=Aliivibrio salmonicida (strain LFI1238) GN=tal PE=3 SV=1 80 236 3.0E-09
sp|P0A867|TALA_ECOLI Transaldolase A OS=Escherichia coli (strain K12) GN=talA PE=3 SV=1 74 242 4.0E-09
sp|P0A868|TALA_ECOL6 Transaldolase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=talA PE=3 SV=1 74 242 4.0E-09
sp|P0A869|TALA_ECO57 Transaldolase A OS=Escherichia coli O157:H7 GN=talA PE=3 SV=1 74 242 4.0E-09
sp|B2J2D9|TAL_NOSP7 Transaldolase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tal PE=3 SV=1 78 241 4.0E-09
sp|Q3YZ89|TAL2_SHISS Transaldolase 2 OS=Shigella sonnei (strain Ss046) GN=tal2 PE=3 SV=1 74 242 4.0E-09
sp|Q822J3|TAL_CHLCV Transaldolase OS=Chlamydophila caviae (strain GPIC) GN=tal PE=3 SV=1 131 242 4.0E-09
sp|P37837|TALDO_HUMAN Transaldolase OS=Homo sapiens GN=TALDO1 PE=1 SV=2 55 254 5.0E-09
sp|Q9S0X4|TAL_METAM Transaldolase OS=Methylomonas aminofaciens GN=tal PE=3 SV=1 10 278 5.0E-09
sp|Q6D0B2|TAL2_PECAS Transaldolase 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tal2 PE=3 SV=1 79 241 5.0E-09
sp|A6VLW0|TAL_ACTSZ Transaldolase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=tal PE=3 SV=1 79 242 6.0E-09
sp|Q83QM8|TALA_SHIFL Transaldolase A OS=Shigella flexneri GN=talA PE=3 SV=1 74 242 6.0E-09
sp|Q255E4|TAL_CHLFF Transaldolase OS=Chlamydophila felis (strain Fe/C-56) GN=tal PE=3 SV=1 85 241 7.0E-09
sp|B3PDM9|TAL_CELJU Transaldolase OS=Cellvibrio japonicus (strain Ueda107) GN=tal PE=3 SV=1 85 307 9.0E-09
sp|Q65PZ8|TAL_MANSM Transaldolase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tal PE=3 SV=1 12 241 1.0E-08
sp|Q5L5I5|TAL_CHLAB Transaldolase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tal PE=3 SV=1 131 242 1.0E-08
sp|A9BXM7|TAL_DELAS Transaldolase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=tal PE=3 SV=1 12 242 2.0E-08
sp|Q21ZD6|TAL_RHOFT Transaldolase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tal PE=3 SV=1 67 242 2.0E-08
sp|P51778|TAL_ANAVT Transaldolase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tal PE=3 SV=2 78 239 2.0E-08
sp|B0UV30|TAL_HISS2 Transaldolase OS=Histophilus somni (strain 2336) GN=tal PE=3 SV=1 12 236 2.0E-08
sp|A5UCY0|TAL_HAEIE Transaldolase OS=Haemophilus influenzae (strain PittEE) GN=tal PE=3 SV=1 12 236 2.0E-08
sp|Q5PCU4|TAL2_SALPA Transaldolase 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tal2 PE=3 SV=1 66 228 3.0E-08
sp|P45055|TAL_HAEIN Transaldolase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tal PE=3 SV=2 12 236 3.0E-08
sp|Q8PNY6|TAL_XANAC Transaldolase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tal PE=3 SV=1 66 241 3.0E-08
sp|Q6MAI4|TAL_PARUW Transaldolase OS=Protochlamydia amoebophila (strain UWE25) GN=tal PE=3 SV=1 12 236 3.0E-08
sp|A5UIP9|TAL_HAEIG Transaldolase OS=Haemophilus influenzae (strain PittGG) GN=tal PE=3 SV=1 12 236 3.0E-08
sp|Q0I1U0|TAL_HAES1 Transaldolase OS=Haemophilus somnus (strain 129Pt) GN=tal PE=3 SV=1 12 236 4.0E-08
sp|P58561|TAL_NOSS1 Transaldolase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tal PE=3 SV=1 78 239 4.0E-08
sp|Q3BX43|TAL_XANC5 Transaldolase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tal PE=3 SV=1 66 241 5.0E-08
sp|Q8VI73|TALDO_CRIGR Transaldolase OS=Cricetulus griseus GN=TALDO1 PE=2 SV=1 55 236 5.0E-08
sp|Q7U5E8|TAL_SYNPX Transaldolase OS=Synechococcus sp. (strain WH8102) GN=tal PE=3 SV=1 10 241 5.0E-08
sp|Q9EQS0|TALDO_RAT Transaldolase OS=Rattus norvegicus GN=Taldo1 PE=1 SV=2 55 236 5.0E-08
sp|Q93092|TALDO_MOUSE Transaldolase OS=Mus musculus GN=Taldo1 PE=1 SV=2 55 236 5.0E-08
sp|Q47WR3|TAL_COLP3 Transaldolase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tal PE=3 SV=1 85 239 6.0E-08
sp|Q8ZN83|TALA_SALTY Transaldolase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=talA PE=3 SV=1 66 228 6.0E-08
sp|B5EUF3|TAL_VIBFM Transaldolase OS=Vibrio fischeri (strain MJ11) GN=tal PE=3 SV=1 76 236 8.0E-08
sp|Q5DZP1|TAL_VIBF1 Transaldolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tal PE=3 SV=1 76 236 8.0E-08
sp|Q7V2G1|TAL_PROMP Transaldolase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tal PE=3 SV=1 10 236 9.0E-08
sp|Q8U7I5|TAL_AGRFC Transaldolase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=tal PE=3 SV=1 10 236 9.0E-08
sp|B5ZQY2|TAL_RHILW Transaldolase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=tal PE=3 SV=1 10 237 1.0E-07
sp|Q4QLG9|TAL_HAEI8 Transaldolase OS=Haemophilus influenzae (strain 86-028NP) GN=tal PE=3 SV=1 12 236 1.0E-07
sp|Q168B1|TAL_ROSDO Probable transaldolase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tal PE=3 SV=1 104 238 1.0E-07
sp|C3LVN8|TAL_VIBCM Transaldolase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=tal PE=3 SV=1 76 236 1.0E-07
sp|Q9KLW8|TAL_VIBCH Transaldolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tal PE=3 SV=1 76 236 1.0E-07
sp|Q1LU10|TAL_BAUCH Transaldolase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tal PE=3 SV=1 79 240 1.0E-07
sp|A4XTM7|TAL_PSEMY Transaldolase OS=Pseudomonas mendocina (strain ymp) GN=tal PE=3 SV=1 70 237 1.0E-07
sp|Q0BX85|TAL_HYPNA Probable transaldolase OS=Hyphomonas neptunium (strain ATCC 15444) GN=tal PE=3 SV=1 104 238 1.0E-07
sp|Q3K9H0|TAL_PSEPF Transaldolase OS=Pseudomonas fluorescens (strain Pf0-1) GN=tal PE=3 SV=1 80 238 2.0E-07
sp|Q1GE05|TAL_RUEST Probable transaldolase OS=Ruegeria sp. (strain TM1040) GN=tal PE=3 SV=1 106 238 2.0E-07
sp|Q97JD9|TAL_CLOAB Probable transaldolase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=tal PE=3 SV=1 83 236 2.0E-07
sp|B1YEL0|TAL_EXIS2 Probable transaldolase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=tal PE=3 SV=1 56 236 3.0E-07
sp|A5F028|TAL_VIBC3 Transaldolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tal PE=3 SV=1 76 236 3.0E-07
sp|Q6D8W0|TAL1_PECAS Transaldolase 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tal1 PE=3 SV=1 127 242 3.0E-07
sp|P15019|TAL1_YEAST Transaldolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAL1 PE=1 SV=4 72 273 4.0E-07
sp|Q89AY3|TAL_BUCBP Transaldolase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=tal PE=3 SV=1 53 236 4.0E-07
sp|Q7VRT4|TAL_BLOFL Transaldolase OS=Blochmannia floridanus GN=tal PE=3 SV=1 34 236 4.0E-07
sp|Q2K414|TAL_RHIEC Transaldolase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tal PE=3 SV=1 10 237 5.0E-07
sp|Q5LAU6|TAL_BACFN Probable transaldolase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tal PE=3 SV=1 135 236 5.0E-07
sp|B9KKW2|TAL_RHOSK Probable transaldolase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=tal PE=3 SV=1 92 238 5.0E-07
sp|Q3J0F0|TAL_RHOS4 Probable transaldolase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=tal PE=3 SV=1 92 238 5.0E-07
sp|A3PLV0|TAL_RHOS1 Probable transaldolase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=tal PE=3 SV=1 92 238 5.0E-07
sp|A9IYY3|TAL_BART1 Probable transaldolase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=tal PE=3 SV=1 134 254 5.0E-07
sp|Q64R94|TAL_BACFR Probable transaldolase OS=Bacteroides fragilis (strain YCH46) GN=tal PE=3 SV=1 135 236 6.0E-07
sp|B1ZUE6|TAL_OPITP Transaldolase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=tal PE=3 SV=1 8 242 6.0E-07
sp|B1J623|TAL_PSEPW Transaldolase OS=Pseudomonas putida (strain W619) GN=tal PE=3 SV=1 78 306 8.0E-07
sp|Q9W1G0|TALDO_DROME Probable transaldolase OS=Drosophila melanogaster GN=Taldo PE=2 SV=2 9 236 8.0E-07
sp|Q9RUP6|TAL_DEIRA Probable transaldolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tal PE=3 SV=2 134 229 1.0E-06
sp|A4WRW1|TAL_RHOS5 Probable transaldolase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=tal PE=3 SV=1 104 238 1.0E-06
sp|A6VYA4|TAL_MARMS Transaldolase OS=Marinomonas sp. (strain MWYL1) GN=tal PE=3 SV=1 81 236 1.0E-06
sp|B1L010|TAL_CLOBM Probable transaldolase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tal PE=3 SV=1 104 241 1.0E-06
sp|C4ZF71|TAL_EUBR3 Probable transaldolase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=tal PE=3 SV=1 134 236 1.0E-06
sp|Q1I7G7|TAL_PSEE4 Transaldolase OS=Pseudomonas entomophila (strain L48) GN=tal PE=3 SV=1 78 241 1.0E-06
sp|Q2NS86|TAL_SODGM Transaldolase OS=Sodalis glossinidius (strain morsitans) GN=tal PE=3 SV=1 127 236 1.0E-06
sp|A5I1C9|TAL_CLOBH Probable transaldolase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=tal PE=3 SV=1 124 241 1.0E-06
sp|A7FTH1|TAL_CLOB1 Probable transaldolase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tal PE=3 SV=1 124 241 1.0E-06
sp|C1FL18|TAL_CLOBJ Probable transaldolase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=tal PE=3 SV=1 124 241 1.0E-06
sp|C3KTY4|TAL_CLOB6 Probable transaldolase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=tal PE=3 SV=1 124 241 1.0E-06
sp|Q8KA27|TAL_BUCAP Transaldolase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=tal PE=3 SV=1 45 240 2.0E-06
sp|A1UR41|TAL_BARBK Probable transaldolase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=tal PE=3 SV=1 133 238 2.0E-06
sp|Q81MY9|TAL2_BACAN Probable transaldolase 2 OS=Bacillus anthracis GN=tal2 PE=3 SV=1 134 237 2.0E-06
sp|B0KHA7|TAL_PSEPG Transaldolase OS=Pseudomonas putida (strain GB-1) GN=tal PE=3 SV=1 78 241 2.0E-06
sp|A7N1Z7|TAL_VIBCB Transaldolase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=tal PE=3 SV=1 76 228 2.0E-06
sp|Q927A3|TAL1_LISIN Probable transaldolase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tal1 PE=3 SV=1 82 236 2.0E-06
sp|A7Z9T0|TAL_BACMF Probable transaldolase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tal PE=3 SV=1 88 237 2.0E-06
sp|Q2NZS1|TAL_XANOM Transaldolase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tal PE=3 SV=1 6 241 3.0E-06
sp|Q8PCA4|TAL_XANCP Transaldolase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tal PE=3 SV=1 50 241 3.0E-06
sp|B0RUE4|TAL_XANCB Transaldolase OS=Xanthomonas campestris pv. campestris (strain B100) GN=tal PE=3 SV=1 50 241 3.0E-06
sp|Q4UR79|TAL_XANC8 Transaldolase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tal PE=3 SV=1 50 241 3.0E-06
sp|B2SQJ4|TAL_XANOP Transaldolase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=tal PE=3 SV=1 6 241 3.0E-06
sp|Q5GWL8|TAL_XANOR Transaldolase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tal PE=3 SV=1 6 241 3.0E-06
sp|Q3AFT3|TAL_CARHZ Probable transaldolase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tal PE=3 SV=1 82 260 3.0E-06
sp|Q88KX1|TAL_PSEPK Transaldolase OS=Pseudomonas putida (strain KT2440) GN=tal PE=3 SV=1 78 241 3.0E-06
sp|A9AZ03|TAL_HERA2 Probable transaldolase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=tal PE=3 SV=1 135 236 3.0E-06
sp|B3EQ72|TAL_CHLPB Probable transaldolase OS=Chlorobium phaeobacteroides (strain BS1) GN=tal PE=3 SV=1 134 236 3.0E-06
sp|Q81B21|TAL2_BACCR Probable transaldolase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tal2 PE=3 SV=1 135 237 4.0E-06
sp|A6WXW5|TAL_OCHA4 Probable transaldolase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=tal PE=3 SV=1 134 236 4.0E-06
sp|Q0AQJ7|TAL_MARMM Probable transaldolase OS=Maricaulis maris (strain MCS10) GN=tal PE=3 SV=1 134 236 4.0E-06
sp|C5BLR8|TAL_TERTT Transaldolase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=tal PE=3 SV=1 77 236 4.0E-06
sp|A7HT46|TAL_PARL1 Probable transaldolase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=tal PE=3 SV=1 106 238 4.0E-06
sp|A9KPQ3|TAL_CLOPH Probable transaldolase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=tal PE=3 SV=1 108 229 5.0E-06
sp|B3Q0T5|TAL_RHIE6 Transaldolase OS=Rhizobium etli (strain CIAT 652) GN=tal PE=3 SV=1 10 237 6.0E-06
sp|Q6MRM6|TAL_BDEBA Probable transaldolase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=tal PE=3 SV=1 133 260 6.0E-06
sp|Q5LNS5|TAL_RUEPO Probable transaldolase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tal PE=3 SV=1 106 234 7.0E-06
sp|Q6G1W4|TAL_BARHE Probable transaldolase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=tal PE=3 SV=1 134 236 7.0E-06
sp|B2A3J5|TAL_NATTJ Probable transaldolase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=tal PE=3 SV=1 134 238 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2552
MASQDAAPVSILDYLRSKTSIDYDSLDLDGRKNLSSGLWEAYLQLSNPQNAVVVQESVELAHKLEREFGGVSVNE
LAVEIAMNKLALRVIPLISGSIHVMCNPLYAWDSEKVYETGHRFHKICRLLEPDFDLSRLVMKVPSTWHGLQACK
RLKTDNIKTLATTLFTMEQVVLAGEVGCTYHDPAPIHALVAQAQRYYKDHNVPTKVKACAFMTTSEIISFAGVDA
MTIPAETLQDLASTHAPPGIESQSVFAGDKNGLKRSERLSFVDDGQKFLRAFATNGRGKAKTEDAIAVFCGFQVE
AEALVASVQV*
Coding >OphauG2|2552
ATGGCTTCTCAAGATGCAGCCCCCGTTAGCATTCTCGACTATCTACGTTCCAAGACTAGCATTGACTACGATAGT
CTTGATCTCGACGGTAGAAAAAACCTCTCGTCAGGCCTTTGGGAGGCATACCTGCAACTATCCAATCCACAGAAT
GCCGTCGTTGTGCAAGAGTCGGTGGAGCTGGCACACAAGCTAGAACGCGAGTTTGGCGGCGTCTCTGTCAATGAA
CTGGCAGTAGAAATTGCTATGAATAAACTTGCGCTTCGCGTCATTCCCCTGATTTCGGGGTCGATTCACGTCATG
TGCAATCCCTTGTATGCGTGGGATTCCGAAAAGGTCTATGAGACGGGGCACCGGTTTCACAAAATCTGTCGTCTT
CTCGAGCCCGACTTTGACTTGTCGAGGCTCGTCATGAAAGTCCCATCAACATGGCATGGTCTCCAGGCCTGCAAA
AGACTCAAAACCGACAATATCAAGACGCTGGCCACCACGCTCTTTACCATGGAGCAGGTCGTCTTGGCTGGAGAA
GTAGGCTGCACCTACCATGACCCAGCTCCCATCCACGCCCTCGTCGCCCAAGCACAGCGCTACTACAAGGACCAC
AACGTGCCTACAAAAGTCAAAGCCTGCGCATTCATGACGACTAGCGAAATCATTTCCTTTGCAGGCGTAGACGCC
ATGACGATTCCGGCGGAAACGCTGCAAGACCTGGCATCGACGCATGCGCCGCCGGGCATTGAATCGCAGTCCGTG
TTTGCTGGAGACAAGAATGGCTTGAAGCGCTCGGAACGGCTGAGCTTTGTAGATGATGGGCAAAAGTTTCTTCGC
GCATTTGCCACGAATGGACGAGGAAAGGCCAAGACGGAAGATGCAATTGCCGTGTTTTGCGGATTCCAGGTAGAG
GCAGAGGCTCTGGTGGCATCGGTGCAAGTGTAG
Transcript >OphauG2|2552
ATGGCTTCTCAAGATGCAGCCCCCGTTAGCATTCTCGACTATCTACGTTCCAAGACTAGCATTGACTACGATAGT
CTTGATCTCGACGGTAGAAAAAACCTCTCGTCAGGCCTTTGGGAGGCATACCTGCAACTATCCAATCCACAGAAT
GCCGTCGTTGTGCAAGAGTCGGTGGAGCTGGCACACAAGCTAGAACGCGAGTTTGGCGGCGTCTCTGTCAATGAA
CTGGCAGTAGAAATTGCTATGAATAAACTTGCGCTTCGCGTCATTCCCCTGATTTCGGGGTCGATTCACGTCATG
TGCAATCCCTTGTATGCGTGGGATTCCGAAAAGGTCTATGAGACGGGGCACCGGTTTCACAAAATCTGTCGTCTT
CTCGAGCCCGACTTTGACTTGTCGAGGCTCGTCATGAAAGTCCCATCAACATGGCATGGTCTCCAGGCCTGCAAA
AGACTCAAAACCGACAATATCAAGACGCTGGCCACCACGCTCTTTACCATGGAGCAGGTCGTCTTGGCTGGAGAA
GTAGGCTGCACCTACCATGACCCAGCTCCCATCCACGCCCTCGTCGCCCAAGCACAGCGCTACTACAAGGACCAC
AACGTGCCTACAAAAGTCAAAGCCTGCGCATTCATGACGACTAGCGAAATCATTTCCTTTGCAGGCGTAGACGCC
ATGACGATTCCGGCGGAAACGCTGCAAGACCTGGCATCGACGCATGCGCCGCCGGGCATTGAATCGCAGTCCGTG
TTTGCTGGAGACAAGAATGGCTTGAAGCGCTCGGAACGGCTGAGCTTTGTAGATGATGGGCAAAAGTTTCTTCGC
GCATTTGCCACGAATGGACGAGGAAAGGCCAAGACGGAAGATGCAATTGCCGTGTTTTGCGGATTCCAGGTAGAG
GCAGAGGCTCTGGTGGCATCGGTGCAAGTGTAG
Gene >OphauG2|2552
ATGGCTTCTCAAGATGCAGCCCCCGTTAGCATTCTCGACTATCTACGTTCCAAGACTAGCATTGACTACGATAGT
CTTGATCTCGACGGTAGAAAAAACCTCTCGTCAGGCCTTGTTTTTTTTTCCTTGTGCTAATCTCGTACCAGGCGC
CGAGAAACTCGGTCCGTTTGCAGACTGCACTTCAAACCAGGCAAGCAACCAGAATGAAAAAAAAAAAAAGACTTA
TACTTTGGACTGACTGGTTGTAGTGGGAGGCATACCTGCAACTATCCAATCCACAGAATGCCGTCGTTGTGCAAG
AGTCGGTGGAGCTGGCACACAAGCTAGAACGCGAGTTTGGCGGCGTCTCTGTCAATGAACTGGCAGTAGAAATTG
CTGTACTGCGGACTCTGACATGACGACGCGCGTGCTGCTAACAATGGGCGCAGATGAATAAACTTGCGCTTCGCG
TCATTCCCCTGATTTCGGGGTCGATTCACGTCATGTGCAATCCCTTGTATGCGTGGGATTCCGAAAAGGTCTATG
AGACGGGGCACCGTGAGTGATTCTTGACCTGAAGCCCATTCGTGACGGCCGCAAGCCAACACTCTTCTTGCCCAG
GGTTTCACAAAATCTGTCGTCTTCTCGAGCCCGACTTTGACTTGTCGAGGCTCGTCATGAAAGTCCCATCAACAT
GGCATGGTCTCCAGGCCTGCAAAAGACTCAAAACCGACAATATCAAGACGCTGGCCACCACGCTCTTTACCATGG
AGCAGGTCGTCTTGGCTGGAGAAGTAGGCTGCACGTCCATCTCGCCCTTTATCCACGAGCTCCGCGCCCACTCTG
AAAGCGAGCAAGTCTCTCTCTCTCGCCACTCTCCCTCTACCTTTTTTCTAACTCTGCGTCAAACTCCCTCAGCTA
CCATGACCCAGCTCCCATCCACGCCCTCGTCGCCCAAGCACAGCGCTACTACAAGGACCACAACGTGCCTACAAA
AGTCAAAGCCTGCGCATTCATGACGACTAGCGAAATCATTTCCTTTGCAGGCGTAGACGCCATGACGATTCCGGC
GGAAACGCTGCAAGACCTGGCATCGACGCATGCGCCGCCGGGCATTGAATCGCAGTCCGTGTTTGCTGGAGACAA
GAATGGCTTGAAGCGCTCGGAACGGCTGAGCTTTGTAGATGATGGGCAAAAGTTTCTTCGCGCATTTGCCACGAA
TGGACGAGGAAAGGCCAAGACGGAAGATGTGAGTGAGAAAAAAGACTCTTTGATTTTTTTTTACTGACCAGAGGA
TAGGCAATTGCCGTGTTTTGCGGATTCCAGGTAGAGGCAGAGGCTCTGGTGGCATCGGTGCAAGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail