Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2546
Gene name
LocationContig_194:15367..16748
Strand-
Gene length (bp)1381
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13012 MitMem_reg Maintenance of mitochondrial structure and function 2.0E-37 209 329
PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease 1.5E-31 50 160

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZY4|RPN8_NEUCR 26S proteasome regulatory subunit rpn-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpn-8 PE=3 SV=1 37 382 0.0E+00
sp|Q6FMD8|RPN8_CANGA 26S proteasome regulatory subunit RPN8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN8 PE=3 SV=1 45 342 2.0E-134
sp|O74440|RPN8_SCHPO 26S proteasome regulatory subunit rpn8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn8 PE=3 SV=1 38 351 3.0E-134
sp|Q75F44|RPN8_ASHGO 26S proteasome regulatory subunit RPN8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPN8 PE=3 SV=1 45 346 5.0E-126
sp|Q08723|RPN8_YEAST 26S proteasome regulatory subunit RPN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN8 PE=1 SV=3 45 356 8.0E-126
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZY4|RPN8_NEUCR 26S proteasome regulatory subunit rpn-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpn-8 PE=3 SV=1 37 382 0.0E+00
sp|Q6FMD8|RPN8_CANGA 26S proteasome regulatory subunit RPN8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN8 PE=3 SV=1 45 342 2.0E-134
sp|O74440|RPN8_SCHPO 26S proteasome regulatory subunit rpn8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn8 PE=3 SV=1 38 351 3.0E-134
sp|Q75F44|RPN8_ASHGO 26S proteasome regulatory subunit RPN8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPN8 PE=3 SV=1 45 346 5.0E-126
sp|Q08723|RPN8_YEAST 26S proteasome regulatory subunit RPN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN8 PE=1 SV=3 45 356 8.0E-126
sp|O24412|PSD7A_ARATH 26S proteasome non-ATPase regulatory subunit 7 homolog A OS=Arabidopsis thaliana GN=RPN8A PE=1 SV=1 52 344 7.0E-120
sp|Q9C774|PSD7B_ARATH 26S proteasome non-ATPase regulatory subunit 7 homolog B OS=Arabidopsis thaliana GN=RPN8B PE=1 SV=1 52 347 3.0E-119
sp|Q3ZBD0|PSMD7_BOVIN 26S proteasome non-ATPase regulatory subunit 7 OS=Bos taurus GN=PSMD7 PE=2 SV=1 45 339 1.0E-111
sp|P51665|PSMD7_HUMAN 26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens GN=PSMD7 PE=1 SV=2 47 335 6.0E-111
sp|P26270|PSMD7_DROME 26S proteasome non-ATPase regulatory subunit 7 OS=Drosophila melanogaster GN=Rpn8 PE=1 SV=6 52 366 8.0E-111
sp|P26516|PSMD7_MOUSE 26S proteasome non-ATPase regulatory subunit 7 OS=Mus musculus GN=Psmd7 PE=1 SV=2 47 335 1.0E-110
sp|Q54WI8|PSMD7_DICDI 26S proteasome non-ATPase regulatory subunit 7 OS=Dictyostelium discoideum GN=psmD7 PE=3 SV=1 54 382 3.0E-102
sp|Q54C92|CSN6_DICDI COP9 signalosome complex subunit 6 OS=Dictyostelium discoideum GN=csn6 PE=1 SV=1 52 341 1.0E-27
sp|Q6NUC2|CSN6_XENLA COP9 signalosome complex subunit 6 OS=Xenopus laevis GN=cops6 PE=2 SV=1 28 285 4.0E-24
sp|O88545|CSN6_MOUSE COP9 signalosome complex subunit 6 OS=Mus musculus GN=Cops6 PE=1 SV=1 34 285 2.0E-23
sp|Q07G98|CSN6_XENTR COP9 signalosome complex subunit 6 OS=Xenopus tropicalis GN=cops6 PE=2 SV=1 35 285 4.0E-23
sp|A7TX81|CSN6_PIG COP9 signalosome complex subunit 6 OS=Sus scrofa GN=COPS6 PE=2 SV=1 46 285 2.0E-22
sp|Q5REY0|CSN6_PONAB COP9 signalosome complex subunit 6 OS=Pongo abelii GN=COPS6 PE=2 SV=1 46 285 3.0E-22
sp|Q7L5N1|CSN6_HUMAN COP9 signalosome complex subunit 6 OS=Homo sapiens GN=COPS6 PE=1 SV=1 48 285 3.0E-22
sp|A6QQ21|CSN6_BOVIN COP9 signalosome complex subunit 6 OS=Bos taurus GN=COPS6 PE=2 SV=1 46 285 3.0E-22
sp|Q9DCH4|EIF3F_MOUSE Eukaryotic translation initiation factor 3 subunit F OS=Mus musculus GN=Eif3f PE=1 SV=2 50 330 2.0E-18
sp|O00303|EIF3F_HUMAN Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens GN=EIF3F PE=1 SV=1 50 330 2.0E-18
sp|A5A6I3|EIF3F_PANTR Eukaryotic translation initiation factor 3 subunit F OS=Pan troglodytes GN=EIF3F PE=2 SV=1 50 330 2.0E-18
sp|Q4R5B8|EIF3F_MACFA Eukaryotic translation initiation factor 3 subunit F OS=Macaca fascicularis GN=EIF3F PE=2 SV=1 50 330 2.0E-18
sp|O43060|EIF3F_SCHPO Eukaryotic translation initiation factor 3 subunit F OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eif3f PE=1 SV=1 51 319 2.0E-18
sp|Q54C49|EIF3F_DICDI Eukaryotic translation initiation factor 3 subunit F OS=Dictyostelium discoideum GN=eif3f PE=3 SV=1 52 334 3.0E-17
sp|B4KBI4|EI3F1_DROMO Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila mojavensis GN=eIF3-S5-1 PE=3 SV=1 52 319 3.0E-17
sp|B4LZ60|EI3F1_DROVI Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila virilis GN=eIF3-S5-1 PE=3 SV=1 45 319 6.0E-17
sp|B4JGX4|EI3F1_DROGR Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila grimshawi GN=eIF3-S5-1 PE=3 SV=1 45 319 1.0E-16
sp|Q9VCY3|CSN6_DROME COP9 signalosome complex subunit 6 OS=Drosophila melanogaster GN=CSN6 PE=1 SV=1 52 336 4.0E-16
sp|B4NJR8|EI3F1_DROWI Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila willistoni GN=eIF3-S5-1 PE=3 SV=1 45 319 5.0E-16
sp|Q4PI88|EIF3F_USTMA Eukaryotic translation initiation factor 3 subunit F OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_00175 PE=3 SV=1 51 320 8.0E-16
sp|Q8W1P0|CSN6B_ARATH COP9 signalosome complex subunit 6b OS=Arabidopsis thaliana GN=CSN6B PE=1 SV=2 56 329 2.0E-15
sp|B3MJ61|EI3F2_DROAN Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila ananassae GN=eIF3-S5-2 PE=3 SV=1 52 319 3.0E-15
sp|Q295I4|EI3F1_DROPS Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S5-1 PE=3 SV=1 45 319 3.0E-15
sp|B4GDU3|EI3F1_DROPE Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila persimilis GN=eIF3-S5-1 PE=3 SV=1 45 319 3.0E-15
sp|B3M123|EI3F1_DROAN Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila ananassae GN=eIF3-S5-1 PE=3 SV=1 45 319 9.0E-15
sp|B4PUG5|EI3F1_DROYA Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila yakuba GN=eIF3-S5-1 PE=3 SV=1 45 319 1.0E-14
sp|B3P239|EI3F1_DROER Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila erecta GN=eIF3-S5-1 PE=3 SV=1 45 319 1.0E-14
sp|B4I3S1|EI3F1_DROSE Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila sechellia GN=eIF3-S5-1 PE=3 SV=1 45 319 1.0E-14
sp|Q9VN50|EI3F1_DROME Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila melanogaster GN=eIF3-S5-1 PE=2 SV=1 45 319 1.0E-14
sp|B4QVL3|EI3F1_DROSI Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila simulans GN=eIF3-S5-1 PE=3 SV=1 45 319 1.0E-14
sp|Q8W206|CSN6A_ARATH COP9 signalosome complex subunit 6a OS=Arabidopsis thaliana GN=CSN6A PE=1 SV=2 56 329 2.0E-14
sp|Q1HR47|EIF3F_AEDAE Eukaryotic translation initiation factor 3 subunit F OS=Aedes aegypti GN=eIF3-S5 PE=2 SV=1 52 319 5.0E-14
sp|Q7QD36|EIF3F_ANOGA Eukaryotic translation initiation factor 3 subunit F OS=Anopheles gambiae GN=eIF3-S5 PE=3 SV=3 52 319 5.0E-14
sp|A8PZS4|EIF3F_MALGO Eukaryotic translation initiation factor 3 subunit F OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_1945 PE=3 SV=1 52 320 6.0E-14
sp|B4QD77|EI3F2_DROSI Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila simulans GN=eIF3-S5-2 PE=3 SV=1 52 319 2.0E-13
sp|O04202|EIF3F_ARATH Eukaryotic translation initiation factor 3 subunit F OS=Arabidopsis thaliana GN=TIF3F1 PE=1 SV=1 38 283 2.0E-13
sp|Q9P748|EIF3F_NEUCR Eukaryotic translation initiation factor 3 subunit F OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=1A9.200 PE=3 SV=2 52 354 2.0E-13
sp|Q1DRC9|EIF3F_COCIM Eukaryotic translation initiation factor 3 subunit F OS=Coccidioides immitis (strain RS) GN=CIMG_07134 PE=3 SV=1 38 319 2.0E-13
sp|A1D3E1|EIF3F_NEOFI Eukaryotic translation initiation factor 3 subunit F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_016300 PE=3 SV=1 51 283 8.0E-13
sp|Q4WTH0|EIF3F_ASPFU Eukaryotic translation initiation factor 3 subunit F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G09330 PE=3 SV=1 51 283 8.0E-13
sp|B0XQ55|EIF3F_ASPFC Eukaryotic translation initiation factor 3 subunit F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_008750 PE=3 SV=1 51 283 8.0E-13
sp|B0X2G0|EIF3F_CULQU Eukaryotic translation initiation factor 3 subunit F OS=Culex quinquefasciatus GN=eIF3-S5 PE=3 SV=1 52 319 8.0E-13
sp|Q2UPM0|EIF3F_ASPOR Eukaryotic translation initiation factor 3 subunit F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005001590 PE=3 SV=1 51 283 9.0E-13
sp|B4II46|EI3F2_DROSE Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila sechellia GN=eIF3-S5-2 PE=3 SV=1 48 319 2.0E-12
sp|A1CQH7|EIF3F_ASPCL Eukaryotic translation initiation factor 3 subunit F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_026150 PE=3 SV=1 51 283 5.0E-12
sp|Q2HGJ2|EIF3F_CHAGB Eukaryotic translation initiation factor 3 subunit F OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_00662 PE=3 SV=1 51 319 2.0E-11
sp|A1Z6K7|EI3F2_DROME Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila melanogaster GN=eIF3-S5-2 PE=3 SV=2 52 218 2.0E-11
sp|A2QQ10|EIF3F_ASPNC Eukaryotic translation initiation factor 3 subunit F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An08g00880 PE=3 SV=1 51 283 2.0E-11
sp|Q0UTQ6|EIF3F_PHANO Eukaryotic translation initiation factor 3 subunit F OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_04858 PE=3 SV=1 38 319 6.0E-11
sp|B3NB67|EI3F2_DROER Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila erecta GN=eIF3-S5-2 PE=3 SV=1 52 202 8.0E-11
sp|A4R0E5|EIF3F_MAGO7 Eukaryotic translation initiation factor 3 subunit F OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10653 PE=3 SV=1 52 319 9.0E-11
sp|A3QVV1|EIF3F_BOMMO Eukaryotic translation initiation factor 3 subunit F OS=Bombyx mori GN=eIF3-S5 PE=2 SV=1 51 244 1.0E-10
sp|Q0CCM5|EIF3F_ASPTN Eukaryotic translation initiation factor 3 subunit F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_08559 PE=3 SV=1 51 283 1.0E-10
sp|B4KSC0|EI3F2_DROMO Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila mojavensis GN=eIF3-S5-2 PE=3 SV=1 52 319 2.0E-10
sp|B4NYU1|EI3F2_DROYA Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila yakuba GN=eIF3-S5-2 PE=3 SV=2 52 202 3.0E-10
sp|B5E1N0|EI3F2_DROPS Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S5-2 PE=3 SV=1 52 332 9.0E-10
sp|Q18967|EIF3F_CAEEL Eukaryotic translation initiation factor 3 subunit F OS=Caenorhabditis elegans GN=eif-3.F PE=3 SV=1 52 182 2.0E-09
sp|B4HBD2|EI3F2_DROPE Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila persimilis GN=eIF3-S5-2 PE=3 SV=1 52 332 2.0E-09
sp|B4MDZ0|EI3F2_DROVI Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila virilis GN=eIF3-S5-2 PE=3 SV=1 52 184 3.0E-09
sp|B4MR33|EI3F2_DROWI Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila willistoni GN=eIF3-S5-2 PE=3 SV=1 52 320 4.0E-08
sp|P41878|RPN11_SCHPO 26S proteasome regulatory subunit rpn11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn11 PE=1 SV=2 49 181 1.0E-07
sp|Q9LT08|PSDE_ARATH 26S proteasome non-ATPase regulatory subunit 14 homolog OS=Arabidopsis thaliana GN=RPN11 PE=1 SV=1 49 185 2.0E-07
sp|Q6C4H1|EIF3F_YARLI Eukaryotic translation initiation factor 3 subunit F OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E26851g PE=3 SV=1 51 162 5.0E-07
sp|Q95PZ0|CSN6_CAEEL COP9 signalosome complex subunit 6 OS=Caenorhabditis elegans GN=csn-6 PE=1 SV=1 48 270 1.0E-06
sp|Q54PF3|CSN5_DICDI COP9 signalosome complex subunit 5 OS=Dictyostelium discoideum GN=csn5 PE=1 SV=1 50 168 2.0E-06
sp|B4J9U3|EI3F2_DROGR Eukaryotic translation initiation factor 3 subunit F-2 OS=Drosophila grimshawi GN=eIF3-S5-2 PE=3 SV=2 52 202 2.0E-06
sp|Q86IJ1|PSDE_DICDI 26S proteasome non-ATPase regulatory subunit 14 OS=Dictyostelium discoideum GN=psmD14 PE=3 SV=1 40 181 5.0E-06
sp|P41883|YPT5_CAEEL Uncharacterized protein F37A4.5 OS=Caenorhabditis elegans GN=F37A4.5 PE=3 SV=1 49 187 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0070122 obsolete isopeptidase activity Yes
GO:0140492 metal-dependent deubiquitinase activity Yes
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0003674 molecular_function No
GO:0008237 metallopeptidase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0101005 deubiquitinase activity No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2546
MTFLLPGRLLQSLLRQTPRAPFCHFEHNNLRNNDSKMPTTTAETLSLVTRNVSVAPLVLLSAVDHYNRTAQSKAK
RRVVGVLLGQNDGNNVRVSNSFAVPFEEDDKDPSVWFLDHNYVESMNDMFKKVNAREKLIGWYHTGPKLRASDLE
INDLFKRYTPHPLLVIIDVQPKESGVPTDAYFAVDEIKDDGTTTSRTFVHIPSIIEAEEAEEIGVEHLLRDIRDV
AVGTLSTRVTNQLQSLQGLHLRLREIGAYLQKVIDGQLPVNHAILGNLQDVFNLLPNLSTPEGGAKSGTSELAHA
MSIKTNDQLMAIYLSSLIRAITAFHDLIDNKIQNRQQQEDKDAKKDDTNAKDDKGDAVNGLNSESKVGTERSKEK
EGKEKKK*
Coding >OphauG2|2546
ATGACATTCCTCCTGCCTGGGCGTCTACTCCAAAGCTTGCTGCGCCAGACACCCAGAGCTCCTTTCTGCCACTTT
GAGCATAATAATCTCCGAAACAACGACTCCAAGATGCCCACCACTACCGCAGAGACCCTATCGCTAGTGACGCGC
AATGTCTCTGTAGCGCCTCTTGTCCTCCTTTCCGCCGTCGACCACTACAATCGGACCGCCCAGAGCAAGGCAAAA
AGAAGAGTTGTTGGTGTGCTGCTTGGCCAAAACGACGGCAATAATGTCAGAGTCTCCAACAGCTTCGCTGTGCCA
TTTGAAGAAGACGACAAAGATCCATCGGTCTGGTTCCTCGACCATAACTACGTCGAGTCGATGAATGACATGTTC
AAAAAAGTCAACGCGCGGGAAAAGTTGATAGGGTGGTACCATACAGGGCCCAAGCTGCGAGCATCGGACCTCGAG
ATCAACGACCTTTTCAAGCGCTACACGCCCCATCCGCTTCTCGTGATTATTGACGTGCAGCCAAAGGAGTCGGGT
GTGCCTACAGACGCATATTTTGCCGTTGATGAGATCAAGGATGACGGAACAACTACGTCAAGGACCTTTGTCCAC
ATCCCCTCAATCATTGAAGCCGAAGAAGCAGAGGAGATTGGCGTGGAGCATCTGCTACGCGACATCCGAGACGTG
GCTGTCGGTACCCTCTCAACCAGGGTTACCAACCAACTGCAGTCGCTGCAGGGCCTTCACCTACGGCTACGTGAA
ATCGGAGCCTATCTGCAAAAGGTGATAGACGGGCAGCTACCGGTCAATCATGCCATTCTGGGCAATCTCCAGGAC
GTCTTCAACCTTTTGCCGAATCTGTCAACCCCAGAAGGCGGCGCCAAATCAGGGACAAGCGAGCTAGCGCACGCC
ATGAGCATCAAGACGAACGATCAACTTATGGCCATCTATCTTAGTAGTTTGATTCGTGCCATTACTGCCTTTCAC
GACTTGATCGATAACAAGATTCAAAATCGACAACAGCAAGAGGACAAAGACGCAAAAAAGGATGACACAAACGCC
AAGGATGACAAAGGAGATGCAGTCAACGGCCTCAACAGTGAGAGCAAGGTTGGAACTGAAAGAAGCAAGGAGAAG
GAAGGCAAAGAGAAGAAGAAATAG
Transcript >OphauG2|2546
ATGACATTCCTCCTGCCTGGGCGTCTACTCCAAAGCTTGCTGCGCCAGACACCCAGAGCTCCTTTCTGCCACTTT
GAGCATAATAATCTCCGAAACAACGACTCCAAGATGCCCACCACTACCGCAGAGACCCTATCGCTAGTGACGCGC
AATGTCTCTGTAGCGCCTCTTGTCCTCCTTTCCGCCGTCGACCACTACAATCGGACCGCCCAGAGCAAGGCAAAA
AGAAGAGTTGTTGGTGTGCTGCTTGGCCAAAACGACGGCAATAATGTCAGAGTCTCCAACAGCTTCGCTGTGCCA
TTTGAAGAAGACGACAAAGATCCATCGGTCTGGTTCCTCGACCATAACTACGTCGAGTCGATGAATGACATGTTC
AAAAAAGTCAACGCGCGGGAAAAGTTGATAGGGTGGTACCATACAGGGCCCAAGCTGCGAGCATCGGACCTCGAG
ATCAACGACCTTTTCAAGCGCTACACGCCCCATCCGCTTCTCGTGATTATTGACGTGCAGCCAAAGGAGTCGGGT
GTGCCTACAGACGCATATTTTGCCGTTGATGAGATCAAGGATGACGGAACAACTACGTCAAGGACCTTTGTCCAC
ATCCCCTCAATCATTGAAGCCGAAGAAGCAGAGGAGATTGGCGTGGAGCATCTGCTACGCGACATCCGAGACGTG
GCTGTCGGTACCCTCTCAACCAGGGTTACCAACCAACTGCAGTCGCTGCAGGGCCTTCACCTACGGCTACGTGAA
ATCGGAGCCTATCTGCAAAAGGTGATAGACGGGCAGCTACCGGTCAATCATGCCATTCTGGGCAATCTCCAGGAC
GTCTTCAACCTTTTGCCGAATCTGTCAACCCCAGAAGGCGGCGCCAAATCAGGGACAAGCGAGCTAGCGCACGCC
ATGAGCATCAAGACGAACGATCAACTTATGGCCATCTATCTTAGTAGTTTGATTCGTGCCATTACTGCCTTTCAC
GACTTGATCGATAACAAGATTCAAAATCGACAACAGCAAGAGGACAAAGACGCAAAAAAGGATGACACAAACGCC
AAGGATGACAAAGGAGATGCAGTCAACGGCCTCAACAGTGAGAGCAAGGTTGGAACTGAAAGAAGCAAGGAGAAG
GAAGGCAAAGAGAAGAAGAAATAG
Gene >OphauG2|2546
ATGACATTCCTCCTGTTCAGAAGCCCGCGTGTCCTCGGTTTCATTCTTTGCGAGCGTTGATACACCAGGCCTGGG
CGTCTACTCCAAAGCTTGCTGCGCCAGACACCCAGAGCTCCTTTCTGCCACTTTGAGCATAATGTACGAATCCCC
TTGACGTGGACGCGCGGGAAAAAACCTTGTTTGTTAATCTTAGCTCTAGAATCTCCGAAACAACGACTCCAAGAT
GCCCACCACTACCGCAGAGACCCTATCGCTAGTGACGCGCAATGTCTCTGTAGCGCCTCTTGTCCTCCTTTCCGC
CGTCGACCACTACAATCGGACCGCCCAGAGCAAGGCAAAAAGAAGAGTTGTTGGTGTGCTGCTTGGCCAAAACGA
CGGCAATAATGTCAGAGTCTCCAACAGCTTCGCTGGTACGCACGACTCTCCTTGGTCATGAATTGCCTACATGCA
TTGGTTCTGACAATCTTGTTAGTGCCATTTGAAGAAGACGACAAAGATCCATCGGTCTGGTTCCTCGACCATAAC
TACGTCGAGTCGATGAATGACATGTTCAAAAAAGTCAACGCGCGGGAAAAGTTGATAGGGTGGTACCATACAGGG
CCCAAGCTGCGAGCATCGGACCTCGAGATCAACGACCTTTTCAAGCGCTACACGCCCCATCCGCTTCTCGTGATT
ATTGACGTGCAGCCAAAGGAGTCGGGTGTGCCTACAGACGCATATTTTGCCGTTGATGAGATCAAGGATGCAAGT
TTAGCCTGCTCGTGGGTGTGGCGGCTACTGTGGCTAATAGTTGAGACAGGACGGAACAACTACGTCAAGGACCTT
TGTCCACATCCCCTCAATCATTGAAGCCGAAGAAGCAGAGGAGATTGGCGTGGAGCATCTGCTACGCGACATCCG
AGACGTGGCTGTCGGTACCCTCTCAACCAGGGTTACCAACCAACTGCAGTCGCTGCAGGGCCTTCACCTACGGCT
ACGTGAAATCGGAGCCTATCTGCAAAAGGTGATAGACGGGCAGCTACCGGTCAATCATGCCATTCTGGGCAATCT
CCAGGACGTCTTCAACCTTTTGCCGAATCTGTCAACCCCAGAAGGCGGCGCCAAATCAGGGACAAGCGAGCTAGC
GCACGCCATGAGCATCAAGACGAACGATCAACTTATGGCCATCTATCTTAGTAGTTTGATTCGTGCCATTACTGC
CTTTCACGACTTGATCGATAACAAGATTCAAAATCGACAACAGCAAGAGGACAAAGACGCAAAAAAGGATGACAC
AAACGCCAAGGATGACAAAGGAGATGCAGTCAACGGCCTCAACAGTGAGAGCAAGGTTGGAACTGAAAGAAGCAA
GGAGAAGGAAGGCAAAGAGAAGAAGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail