Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|254
Gene name
LocationContig_105:25572..28229
Strand+
Gene length (bp)2657
Transcript length (bp)2238
Coding sequence length (bp)2238
Protein length (aa) 746

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) 2.2E-29 397 622
PF03129 HGTP_anticodon Anticodon binding domain 8.8E-17 635 727
PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain 1.7E-12 247 294
PF02824 TGS TGS domain 1.5E-11 77 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87144|SYTC_SCHPO Threonine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ths1 PE=3 SV=1 28 717 0.0E+00
sp|P04801|SYTC_YEAST Threonine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THS1 PE=1 SV=2 1 737 0.0E+00
sp|Q3ZBV8|SYTC_BOVIN Threonine--tRNA ligase, cytoplasmic OS=Bos taurus GN=TARS PE=2 SV=1 1 733 0.0E+00
sp|Q9D0R2|SYTC_MOUSE Threonine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Tars PE=1 SV=2 42 733 0.0E+00
sp|Q5XHY5|SYTC_RAT Threonine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Tars PE=1 SV=1 28 733 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87144|SYTC_SCHPO Threonine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ths1 PE=3 SV=1 28 717 0.0E+00
sp|P04801|SYTC_YEAST Threonine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THS1 PE=1 SV=2 1 737 0.0E+00
sp|Q3ZBV8|SYTC_BOVIN Threonine--tRNA ligase, cytoplasmic OS=Bos taurus GN=TARS PE=2 SV=1 1 733 0.0E+00
sp|Q9D0R2|SYTC_MOUSE Threonine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Tars PE=1 SV=2 42 733 0.0E+00
sp|Q5XHY5|SYTC_RAT Threonine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Tars PE=1 SV=1 28 733 0.0E+00
sp|P26639|SYTC_HUMAN Threonine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=TARS PE=1 SV=3 42 733 0.0E+00
sp|A2RTX5|SYTC2_HUMAN Probable threonine--tRNA ligase 2, cytoplasmic OS=Homo sapiens GN=TARSL2 PE=1 SV=1 5 735 0.0E+00
sp|Q0V9S0|SYTC2_XENTR Probable threonine--tRNA ligase 2, cytoplasmic OS=Xenopus tropicalis GN=tarsl2 PE=2 SV=1 11 743 0.0E+00
sp|Q8BLY2|SYTC2_MOUSE Probable threonine--tRNA ligase 2, cytoplasmic OS=Mus musculus GN=Tarsl2 PE=1 SV=1 27 735 0.0E+00
sp|P52709|SYTC_CAEEL Threonine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=trs-1 PE=3 SV=1 32 707 0.0E+00
sp|Q54J66|SYTC1_DICDI Probable threonine--tRNA ligase 1, cytoplasmic OS=Dictyostelium discoideum GN=thrS1 PE=3 SV=1 41 707 0.0E+00
sp|O04630|SYTM1_ARATH Threonine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana GN=THRRS PE=2 SV=3 19 714 0.0E+00
sp|A6QNM8|SYTC2_BOVIN Probable threonine--tRNA ligase 2, cytoplasmic OS=Bos taurus GN=TARSL2 PE=2 SV=1 24 649 0.0E+00
sp|Q68FW7|SYTM_RAT Threonine--tRNA ligase, mitochondrial OS=Rattus norvegicus GN=Tars2 PE=2 SV=1 43 733 0.0E+00
sp|Q3UQ84|SYTM_MOUSE Threonine--tRNA ligase, mitochondrial OS=Mus musculus GN=Tars2 PE=1 SV=1 44 733 0.0E+00
sp|Q9BW92|SYTM_HUMAN Threonine--tRNA ligase, mitochondrial OS=Homo sapiens GN=TARS2 PE=1 SV=1 31 733 0.0E+00
sp|Q8SRH2|SYTC_ENCCU Probable threonine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_1570 PE=3 SV=1 93 703 0.0E+00
sp|B7XIA1|SYTC_ENTBH Probable threonine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22768 PE=3 SV=1 115 717 1.0E-179
sp|P18256|SYT2_BACSU Threonine--tRNA ligase 2 OS=Bacillus subtilis (strain 168) GN=thrZ PE=2 SV=2 76 728 4.0E-170
sp|Q9WZJ9|SYT_THEMA Threonine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=thrS PE=3 SV=1 75 741 9.0E-170
sp|A5IJ45|SYT_THEP1 Threonine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=thrS PE=3 SV=1 75 741 2.0E-169
sp|B1L7W6|SYT_THESQ Threonine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=thrS PE=3 SV=1 75 741 2.0E-167
sp|B9KAN7|SYT_THENN Threonine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=thrS PE=3 SV=1 75 741 8.0E-167
sp|B0S169|SYT_FINM2 Threonine--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=thrS PE=3 SV=1 92 713 2.0E-166
sp|A9A078|SYT_DESOH Threonine--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=thrS PE=3 SV=1 76 728 3.0E-166
sp|Q8MP20|SYTC2_DICDI Probable threonine--tRNA ligase 2, cytoplasmic OS=Dictyostelium discoideum GN=thrS2 PE=3 SV=1 94 706 1.0E-164
sp|Q3ABS6|SYT_CARHZ Threonine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=thrS PE=3 SV=1 76 727 5.0E-164
sp|A3DET1|SYT_CLOTH Threonine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=thrS PE=3 SV=1 76 719 1.0E-163
sp|C0QAP1|SYT_DESAH Threonine--tRNA ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=thrS PE=3 SV=1 97 706 2.0E-163
sp|Q8RFS6|SYT_FUSNN Threonine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=thrS PE=3 SV=1 97 713 2.0E-161
sp|Q0AM08|SYT_MARMM Threonine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=thrS PE=3 SV=1 76 726 4.0E-159
sp|Q4UKU3|SYT_RICFE Threonine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=thrS PE=3 SV=1 76 719 9.0E-159
sp|Q30Y11|SYT_DESAG Threonine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=thrS PE=3 SV=1 100 722 9.0E-159
sp|A8GML4|SYT_RICAH Threonine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=thrS PE=3 SV=1 76 719 2.0E-158
sp|B8FN26|SYT_DESAA Threonine--tRNA ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=thrS PE=3 SV=1 76 706 2.0E-158
sp|A4J4Y7|SYT_DESRM Threonine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=thrS PE=3 SV=1 76 705 8.0E-158
sp|Q2RNL4|SYT_RHORT Threonine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=thrS PE=3 SV=1 76 741 1.0E-157
sp|Q6M9L0|SYT_PARUW Threonine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=thrS PE=3 SV=1 63 707 2.0E-157
sp|Q0AY05|SYT_SYNWW Threonine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=thrS PE=3 SV=1 76 713 2.0E-157
sp|C5CI64|SYT_KOSOT Threonine--tRNA ligase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=thrS PE=3 SV=1 78 705 3.0E-157
sp|A1WU53|SYT_HALHL Threonine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=thrS PE=3 SV=1 77 743 4.0E-157
sp|Q8R9A4|SYT_CALS4 Threonine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=thrS PE=3 SV=1 94 735 7.0E-157
sp|A9BHF0|SYT_PETMO Threonine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=thrS PE=3 SV=1 94 712 2.0E-156
sp|Q0AAL5|SYT_ALKEH Threonine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=thrS PE=3 SV=1 77 712 3.0E-156
sp|A1ARE5|SYT_PELPD Threonine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=thrS PE=3 SV=1 76 709 1.0E-155
sp|Q189B8|SYT_PEPD6 Threonine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=thrS PE=3 SV=1 97 706 1.0E-155
sp|C4K0X3|SYT_RICPU Threonine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=thrS PE=3 SV=1 76 719 2.0E-154
sp|Q8F6R1|SYT_LEPIN Threonine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=thrS PE=3 SV=1 106 711 3.0E-154
sp|Q72PK6|SYT_LEPIC Threonine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=thrS PE=3 SV=1 106 711 3.0E-154
sp|Q31F14|SYT_THICR Threonine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=thrS PE=3 SV=1 78 726 3.0E-154
sp|A5WHD5|SYT_PSYWF Threonine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=thrS PE=3 SV=1 76 709 4.0E-154
sp|B2A5P2|SYT_NATTJ Threonine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=thrS PE=3 SV=1 97 717 6.0E-154
sp|Q92IX4|SYT_RICCN Threonine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=thrS PE=3 SV=1 76 719 1.0E-153
sp|C3PMR6|SYT_RICAE Threonine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=thrS PE=3 SV=1 76 719 1.0E-153
sp|Q3A4P3|SYT_PELCD Threonine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=thrS PE=3 SV=1 76 711 2.0E-153
sp|Q4ZUG7|SYT_PSEU2 Threonine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=thrS PE=3 SV=1 78 733 5.0E-153
sp|A8GR83|SYT_RICRS Threonine--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=thrS PE=3 SV=1 76 719 5.0E-153
sp|Q883H9|SYT_PSESM Threonine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=thrS PE=3 SV=1 78 733 6.0E-153
sp|Q60AZ3|SYT_METCA Threonine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=thrS PE=3 SV=1 77 717 9.0E-153
sp|C0MCN7|SYT_STRS7 Threonine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=thrS PE=3 SV=1 76 714 2.0E-152
sp|B1L0T7|SYT_CLOBM Threonine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=thrS PE=3 SV=1 96 707 4.0E-152
sp|A6V485|SYT_PSEA7 Threonine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=thrS PE=3 SV=1 78 733 5.0E-152
sp|C3KTK0|SYT_CLOB6 Threonine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=thrS PE=3 SV=1 96 707 5.0E-152
sp|A4VM22|SYT_PSEU5 Threonine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=thrS PE=3 SV=1 78 734 5.0E-152
sp|B6IV67|SYT_RHOCS Threonine--tRNA ligase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=thrS PE=3 SV=1 76 717 5.0E-152
sp|Q9I099|SYT_PSEAE Threonine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=thrS PE=3 SV=1 78 733 7.0E-152
sp|Q02NP1|SYT_PSEAB Threonine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=thrS PE=3 SV=1 78 733 7.0E-152
sp|B7V188|SYT_PSEA8 Threonine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=thrS PE=3 SV=1 78 733 7.0E-152
sp|Q48JS3|SYT_PSE14 Threonine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=thrS PE=3 SV=1 78 733 8.0E-152
sp|Q68XE8|SYT_RICTY Threonine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=thrS PE=3 SV=1 76 703 1.0E-151
sp|Q1RJ48|SYT_RICBR Threonine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=thrS PE=3 SV=1 76 726 2.0E-151
sp|A8GVV1|SYT_RICB8 Threonine--tRNA ligase OS=Rickettsia bellii (strain OSU 85-389) GN=thrS PE=3 SV=1 76 726 2.0E-151
sp|Q67LA3|SYT_SYMTH Threonine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=thrS PE=3 SV=1 76 705 2.0E-151
sp|B1IMV3|SYT_CLOBK Threonine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=thrS PE=3 SV=1 96 707 2.0E-151
sp|Q2SDJ2|SYT_HAHCH Threonine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=thrS PE=3 SV=1 77 734 3.0E-151
sp|O05947|SYT_RICPR Threonine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=thrS PE=3 SV=1 76 703 3.0E-151
sp|Q1Q809|SYT_PSYCK Threonine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=thrS PE=3 SV=1 76 722 4.0E-151
sp|B8J823|SYT_ANAD2 Threonine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=thrS PE=3 SV=1 76 703 4.0E-151
sp|C1FKN0|SYT_CLOBJ Threonine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=thrS PE=3 SV=1 96 707 5.0E-151
sp|A4XTS1|SYT_PSEMY Threonine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=thrS PE=3 SV=1 77 706 5.0E-151
sp|A9ABF9|SYT_BURM1 Threonine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=thrS PE=3 SV=1 76 705 7.0E-151
sp|Q0BXC2|SYT_HYPNA Threonine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=thrS PE=3 SV=1 76 726 7.0E-151
sp|B3R4J1|SYT_CUPTR Threonine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=thrS PE=3 SV=1 76 731 1.0E-150
sp|Q1D6E3|SYT_MYXXD Threonine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=thrS PE=3 SV=1 76 703 1.0E-150
sp|A7GI05|SYT_CLOBL Threonine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=thrS PE=3 SV=1 96 707 1.0E-150
sp|Q74D04|SYT_GEOSL Threonine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=thrS PE=3 SV=2 75 706 1.0E-150
sp|A5I6L8|SYT_CLOBH Threonine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=thrS PE=3 SV=1 96 707 2.0E-150
sp|A7FY87|SYT_CLOB1 Threonine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=thrS PE=3 SV=1 96 707 2.0E-150
sp|Q5WT82|SYT_LEGPL Threonine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=thrS PE=3 SV=1 78 706 2.0E-150
sp|B4UAM8|SYT_ANASK Threonine--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=thrS PE=3 SV=1 76 703 2.0E-150
sp|A5IAK9|SYT_LEGPC Threonine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=thrS PE=3 SV=1 78 706 2.0E-150
sp|Q63TM2|SYT_BURPS Threonine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=thrS PE=3 SV=1 76 705 3.0E-150
sp|A3N8T1|SYT_BURP6 Threonine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=thrS PE=3 SV=1 76 705 3.0E-150
sp|Q3JT13|SYT_BURP1 Threonine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=thrS PE=3 SV=1 76 705 3.0E-150
sp|A3NUI4|SYT_BURP0 Threonine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=thrS PE=3 SV=1 76 705 3.0E-150
sp|A1V3R3|SYT_BURMS Threonine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=thrS PE=3 SV=1 76 705 3.0E-150
sp|Q62KI2|SYT_BURMA Threonine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=thrS PE=3 SV=1 76 705 3.0E-150
sp|A2S2N6|SYT_BURM9 Threonine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=thrS PE=3 SV=1 76 705 3.0E-150
sp|A3MJT8|SYT_BURM7 Threonine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=thrS PE=3 SV=1 76 705 3.0E-150
sp|Q8XZ29|SYT_RALSO Threonine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=thrS PE=3 SV=1 76 726 3.0E-150
sp|A8EXW5|SYT_RICCK Threonine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=thrS PE=3 SV=1 76 719 3.0E-150
sp|Q5ZS05|SYT_LEGPH Threonine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=thrS PE=3 SV=2 78 706 4.0E-150
sp|Q88K27|SYT_PSEPK Threonine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=thrS PE=3 SV=1 77 733 5.0E-150
sp|A5N258|SYT_CLOK5 Threonine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=thrS PE=3 SV=1 76 705 6.0E-150
sp|B9E5W0|SYT_CLOK1 Threonine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=thrS PE=3 SV=1 76 705 6.0E-150
sp|B2V6M2|SYT_SULSY Threonine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=thrS PE=3 SV=1 110 712 8.0E-150
sp|Q891T0|SYT_CLOTE Threonine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=thrS PE=3 SV=1 96 705 9.0E-150
sp|Q5X1H3|SYT_LEGPA Threonine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=thrS PE=3 SV=1 78 706 1.0E-149
sp|Q472N7|SYT_CUPPJ Threonine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=thrS PE=3 SV=1 76 726 1.0E-149
sp|Q1MRV8|SYT_LAWIP Threonine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=thrS PE=3 SV=1 115 721 1.0E-149
sp|Q82VV1|SYT_NITEU Threonine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=thrS PE=3 SV=1 77 708 2.0E-149
sp|A5W5E1|SYT_PSEP1 Threonine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=thrS PE=3 SV=1 77 733 2.0E-149
sp|Q2SVD8|SYT_BURTA Threonine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=thrS PE=3 SV=1 76 705 2.0E-149
sp|Q3J0X4|SYT_RHOS4 Threonine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=thrS PE=3 SV=1 75 714 2.0E-149
sp|B9KKC7|SYT_RHOSK Threonine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=thrS PE=3 SV=1 75 714 3.0E-149
sp|A8F8Q8|SYT_PSELT Threonine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=thrS PE=3 SV=1 95 737 3.0E-149
sp|A0PZN1|SYT_CLONN Threonine--tRNA ligase OS=Clostridium novyi (strain NT) GN=thrS PE=3 SV=1 94 705 4.0E-149
sp|Q7NYC6|SYT_CHRVO Threonine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=thrS PE=3 SV=1 78 711 4.0E-149
sp|Q821I3|SYT_CHLCV Threonine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=thrS PE=3 SV=1 94 708 4.0E-149
sp|Q0KBZ3|SYT_CUPNH Threonine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=thrS PE=3 SV=1 76 726 4.0E-149
sp|A3PLC6|SYT_RHOS1 Threonine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=thrS PE=3 SV=1 75 714 4.0E-149
sp|Q39H55|SYT_BURL3 Threonine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=thrS PE=3 SV=1 76 705 4.0E-149
sp|B5XKA6|SYT_STRPZ Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=thrS PE=3 SV=1 76 713 5.0E-149
sp|B1J6U4|SYT_PSEPW Threonine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=thrS PE=3 SV=1 78 733 8.0E-149
sp|B5XQC6|SYT_KLEP3 Threonine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=thrS PE=3 SV=1 77 736 9.0E-149
sp|Q5XDC4|SYT_STRP6 Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=thrS PE=3 SV=1 76 713 1.0E-148
sp|B9DU13|SYT_STRU0 Threonine--tRNA ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=thrS PE=3 SV=1 76 727 1.0E-148
sp|Q98LR2|SYT_RHILO Threonine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=thrS PE=3 SV=1 76 728 1.0E-148
sp|A1U2C3|SYT_MARHV Threonine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=thrS PE=3 SV=1 77 712 2.0E-148
sp|Q48US7|SYT_STRPM Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=thrS PE=3 SV=1 76 713 2.0E-148
sp|P0DG59|SYT_STRPQ Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=thrS PE=3 SV=1 76 713 2.0E-148
sp|P0DG58|SYT_STRP3 Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=thrS PE=3 SV=1 76 713 2.0E-148
sp|Q1IC15|SYT_PSEE4 Threonine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=thrS PE=3 SV=1 77 706 2.0E-148
sp|B1YP13|SYT_BURA4 Threonine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=thrS PE=3 SV=1 76 705 2.0E-148
sp|Q5L4T1|SYT_CHLAB Threonine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=thrS PE=3 SV=1 93 724 2.0E-148
sp|A2RFY5|SYT_STRPG Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=thrS PE=3 SV=1 76 713 2.0E-148
sp|Q1JMY5|SYT_STRPC Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=thrS PE=3 SV=1 76 713 2.0E-148
sp|Q1JD10|SYT_STRPB Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=thrS PE=3 SV=1 76 713 2.0E-148
sp|Q8P234|SYT_STRP8 Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=thrS PE=3 SV=1 76 713 2.0E-148
sp|Q9A115|SYT_STRP1 Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=thrS PE=3 SV=1 76 713 2.0E-148
sp|Q9PJF9|SYT_CHLMU Threonine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=thrS PE=3 SV=1 121 708 2.0E-148
sp|C0R403|SYT_WOLWR Threonine--tRNA ligase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=thrS PE=3 SV=1 106 728 3.0E-148
sp|B0KKR8|SYT_PSEPG Threonine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=thrS PE=3 SV=1 77 733 3.0E-148
sp|Q0BG06|SYT_BURCM Threonine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=thrS PE=3 SV=1 76 705 3.0E-148
sp|Q04ZG7|SYT_LEPBL Threonine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=thrS PE=3 SV=1 106 712 3.0E-148
sp|Q04R58|SYT_LEPBJ Threonine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=thrS PE=3 SV=1 106 712 3.0E-148
sp|A4JDU4|SYT_BURVG Threonine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=thrS PE=3 SV=1 76 705 3.0E-148
sp|B4E7I6|SYT_BURCJ Threonine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=thrS PE=3 SV=1 76 705 4.0E-148
sp|Q1J7X1|SYT_STRPF Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=thrS PE=3 SV=1 76 713 5.0E-148
sp|B0BA34|SYT_CHLTB Threonine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=thrS PE=3 SV=1 121 708 5.0E-148
sp|B0B8F5|SYT_CHLT2 Threonine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=thrS PE=3 SV=1 121 708 5.0E-148
sp|B2SZG2|SYT_BURPP Threonine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=thrS PE=3 SV=1 76 705 5.0E-148
sp|B4RSL8|SYT_ALTMD Threonine--tRNA ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=thrS PE=3 SV=1 77 728 5.0E-148
sp|O84585|SYT_CHLTR Threonine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=thrS PE=3 SV=2 121 708 6.0E-148
sp|Q3KLB6|SYT_CHLTA Threonine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=thrS PE=3 SV=1 121 708 6.0E-148
sp|Q97GK4|SYT_CLOAB Threonine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thrS PE=3 SV=1 93 705 6.0E-148
sp|Q13WF7|SYT_BURXL Threonine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=thrS PE=3 SV=1 76 705 6.0E-148
sp|B4ETK6|SYT_PROMH Threonine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=thrS PE=3 SV=1 78 705 7.0E-148
sp|C5CUU2|SYT_VARPS Threonine--tRNA ligase OS=Variovorax paradoxus (strain S110) GN=thrS PE=3 SV=1 76 734 8.0E-148
sp|Q4FPW3|SYT_PSYA2 Threonine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=thrS PE=3 SV=1 76 722 9.0E-148
sp|A1VR77|SYT_POLNA Threonine--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=thrS PE=3 SV=1 76 708 9.0E-148
sp|B3PL16|SYT_CELJU Threonine--tRNA ligase OS=Cellvibrio japonicus (strain Ueda107) GN=thrS PE=3 SV=1 77 733 1.0E-147
sp|A5EZ18|SYT_VIBC3 Threonine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=thrS PE=3 SV=1 78 705 1.0E-147
sp|Q256F9|SYT_CHLFF Threonine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=thrS PE=3 SV=1 93 708 1.0E-147
sp|C3LUV8|SYT_VIBCM Threonine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=thrS PE=3 SV=1 78 705 1.0E-147
sp|Q9KMN7|SYT_VIBCH Threonine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thrS PE=3 SV=1 78 705 1.0E-147
sp|A7I107|SYT_CAMHC Threonine--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=thrS PE=3 SV=1 114 705 1.0E-147
sp|B9KEB1|SYT_CAMLR Threonine--tRNA ligase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=thrS PE=3 SV=1 107 721 1.0E-147
sp|Q1JI30|SYT_STRPD Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=thrS PE=3 SV=1 76 714 1.0E-147
sp|Q32FI0|SYT_SHIDS Threonine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thrS PE=3 SV=1 77 736 1.0E-147
sp|A4SX33|SYT_POLSQ Threonine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=thrS PE=3 SV=1 77 705 2.0E-147
sp|B8GRI1|SYT_THISH Threonine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=thrS PE=3 SV=1 78 737 2.0E-147
sp|B5EN57|SYT_ACIF5 Threonine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=thrS PE=3 SV=1 78 708 2.0E-147
sp|B7J7T0|SYT_ACIF2 Threonine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=thrS PE=3 SV=1 78 708 2.0E-147
sp|A4WQU1|SYT_RHOS5 Threonine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=thrS PE=3 SV=1 75 726 2.0E-147
sp|B6IBD7|SYT_ECOSE Threonine--tRNA ligase OS=Escherichia coli (strain SE11) GN=thrS PE=3 SV=1 77 736 3.0E-147
sp|B1IPK9|SYT_ECOLC Threonine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=thrS PE=3 SV=1 77 736 3.0E-147
sp|A8A0R2|SYT_ECOHS Threonine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=thrS PE=3 SV=1 77 736 3.0E-147
sp|B7L6J2|SYT_ECO55 Threonine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=thrS PE=3 SV=1 77 736 3.0E-147
sp|A7ZMI6|SYT_ECO24 Threonine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=thrS PE=3 SV=1 77 736 3.0E-147
sp|A5EVK6|SYT_DICNV Threonine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=thrS PE=3 SV=1 77 731 3.0E-147
sp|B1K091|SYT_BURCC Threonine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=thrS PE=3 SV=1 76 705 4.0E-147
sp|Q73GH6|SYT_WOLPM Threonine--tRNA ligase OS=Wolbachia pipientis wMel GN=thrS PE=3 SV=1 107 728 4.0E-147
sp|Q3Z267|SYT_SHISS Threonine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|P0A8M5|SYT_SHIFL Threonine--tRNA ligase OS=Shigella flexneri GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|Q0T4S9|SYT_SHIF8 Threonine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|Q1RB76|SYT_ECOUT Threonine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|B1LE12|SYT_ECOSM Threonine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|B7N556|SYT_ECOLU Threonine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|P0A8M3|SYT_ECOLI Threonine--tRNA ligase OS=Escherichia coli (strain K12) GN=thrS PE=1 SV=1 77 736 5.0E-147
sp|P0A8M4|SYT_ECOL6 Threonine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|Q0THB0|SYT_ECOL5 Threonine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|A1ABQ2|SYT_ECOK1 Threonine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|B1XGI1|SYT_ECODH Threonine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|C4ZYI1|SYT_ECOBW Threonine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|B7MVJ7|SYT_ECO81 Threonine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|B7NT58|SYT_ECO7I Threonine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|B7MAS9|SYT_ECO45 Threonine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|B7USA2|SYT_ECO27 Threonine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=thrS PE=3 SV=1 77 736 5.0E-147
sp|A4W9M3|SYT_ENT38 Threonine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=thrS PE=3 SV=1 77 736 6.0E-147
sp|A1USJ2|SYT_BARBK Threonine--tRNA ligase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=thrS PE=3 SV=1 76 727 7.0E-147
sp|A8FK07|SYT_CAMJ8 Threonine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=thrS PE=3 SV=1 107 719 8.0E-147
sp|B5YQ07|SYT_ECO5E Threonine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=thrS PE=3 SV=1 77 736 9.0E-147
sp|Q8XE27|SYT_ECO57 Threonine--tRNA ligase OS=Escherichia coli O157:H7 GN=thrS PE=3 SV=1 77 736 9.0E-147
sp|Q8Z6I2|SYT_SALTI Threonine--tRNA ligase OS=Salmonella typhi GN=thrS PE=3 SV=1 77 736 1.0E-146
sp|B4TUF0|SYT_SALSV Threonine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=thrS PE=3 SV=1 77 736 1.0E-146
sp|B5F7G2|SYT_SALA4 Threonine--tRNA ligase OS=Salmonella agona (strain SL483) GN=thrS PE=3 SV=1 77 736 1.0E-146
sp|C6DYJ5|SYT_GEOSM Threonine--tRNA ligase OS=Geobacter sp. (strain M21) GN=thrS PE=3 SV=1 75 712 1.0E-146
sp|B9JFG4|SYT_AGRRK Threonine--tRNA ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=thrS PE=3 SV=1 74 726 1.0E-146
sp|Q46LV3|SYT_PROMT Threonine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=thrS PE=3 SV=1 78 706 1.0E-146
sp|B7M1C7|SYT_ECO8A Threonine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=thrS PE=3 SV=1 77 736 2.0E-146
sp|Q9K095|SYT_NEIMB Threonine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=thrS PE=3 SV=1 76 705 2.0E-146
sp|B8DPN2|SYT_DESVM Threonine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=thrS PE=3 SV=1 101 709 2.0E-146
sp|B2UGJ8|SYT_RALPJ Threonine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=thrS PE=3 SV=1 76 726 2.0E-146
sp|C1CLX1|SYT_STRZP Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=thrS PE=3 SV=1 76 712 2.0E-146
sp|Q8E0L9|SYT_STRA5 Threonine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=thrS PE=3 SV=1 76 713 3.0E-146
sp|Q3K1Z4|SYT_STRA1 Threonine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=thrS PE=3 SV=1 76 713 3.0E-146
sp|A9IVB0|SYT_BART1 Threonine--tRNA ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=thrS PE=3 SV=1 76 703 3.0E-146
sp|Q3JC02|SYT_NITOC Threonine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=thrS PE=3 SV=1 77 726 3.0E-146
sp|B2JJJ7|SYT_BURP8 Threonine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=thrS PE=3 SV=1 76 705 3.0E-146
sp|A6U8C7|SYT_SINMW Threonine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=thrS PE=3 SV=1 76 738 3.0E-146
sp|C1CSP6|SYT_STRZT Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=thrS PE=3 SV=1 76 712 3.0E-146
sp|B1I703|SYT_STRPI Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=thrS PE=3 SV=1 76 712 3.0E-146
sp|C1C8M1|SYT_STRP7 Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=thrS PE=3 SV=1 76 712 3.0E-146
sp|B5E6Q8|SYT_STRP4 Threonine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=thrS PE=3 SV=1 76 712 3.0E-146
sp|Q2IJC0|SYT_ANADE Threonine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=thrS PE=3 SV=1 76 703 3.0E-146
sp|Q8E693|SYT_STRA3 Threonine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=thrS PE=3 SV=1 76 713 3.0E-146
sp|Q8ZPS9|SYT_SALTY Threonine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thrS PE=3 SV=1 77 736 4.0E-146
sp|B4TGH1|SYT_SALHS Threonine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=thrS PE=3 SV=1 77 736 4.0E-146
sp|Q11JM1|SYT_CHESB Threonine--tRNA ligase OS=Chelativorans sp. (strain BNC1) GN=thrS PE=3 SV=1 74 727 4.0E-146
sp|A9N243|SYT_SALPB Threonine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=thrS PE=3 SV=1 77 736 4.0E-146
sp|B4T4M8|SYT_SALNS Threonine--tRNA ligase OS=Salmonella newport (strain SL254) GN=thrS PE=3 SV=1 77 736 4.0E-146
sp|B5QVW8|SYT_SALEP Threonine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=thrS PE=3 SV=1 77 736 4.0E-146
sp|B5FJA8|SYT_SALDC Threonine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=thrS PE=3 SV=1 77 736 4.0E-146
sp|Q321L0|SYT_SHIBS Threonine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=thrS PE=3 SV=1 77 736 4.0E-146
sp|B2U397|SYT_SHIB3 Threonine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=thrS PE=3 SV=1 77 736 4.0E-146
sp|Q97PI4|SYT_STRPN Threonine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=thrS PE=1 SV=1 76 712 4.0E-146
sp|B5BA42|SYT_SALPK Threonine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=thrS PE=3 SV=1 77 736 4.0E-146
sp|Q5PH96|SYT_SALPA Threonine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=thrS PE=3 SV=1 77 736 4.0E-146
sp|A6L9S2|SYT_PARD8 Threonine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=thrS PE=3 SV=1 76 705 5.0E-146
sp|Q5HWW3|SYT_CAMJR Threonine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=thrS PE=3 SV=1 107 719 5.0E-146
sp|B7LQ71|SYT_ESCF3 Threonine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=thrS PE=3 SV=1 77 736 5.0E-146
sp|B5RAX3|SYT_SALG2 Threonine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=thrS PE=3 SV=1 77 736 6.0E-146
sp|Q6N4D3|SYT_RHOPA Threonine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=thrS PE=3 SV=1 74 727 6.0E-146
sp|Q57PV3|SYT_SALCH Threonine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=thrS PE=3 SV=1 77 736 7.0E-146
sp|Q5QYN4|SYT_IDILO Threonine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=thrS PE=3 SV=1 77 705 7.0E-146
sp|A1VBB4|SYT_DESVV Threonine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=thrS PE=3 SV=1 101 722 7.0E-146
sp|Q728R5|SYT_DESVH Threonine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=thrS PE=3 SV=1 101 722 7.0E-146
sp|B7I688|SYT_ACIB5 Threonine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=thrS PE=3 SV=1 78 734 8.0E-146
sp|A2C155|SYT_PROM1 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=thrS PE=3 SV=1 78 706 9.0E-146
sp|B0V5P2|SYT_ACIBY Threonine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=thrS PE=3 SV=1 78 734 1.0E-145
sp|A3M299|SYT_ACIBT Threonine--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=thrS PE=3 SV=2 78 734 1.0E-145
sp|B2HTH0|SYT_ACIBC Threonine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=thrS PE=3 SV=1 78 734 1.0E-145
sp|B7H005|SYT_ACIB3 Threonine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=thrS PE=3 SV=1 78 734 1.0E-145
sp|Q6MML0|SYT_BDEBA Threonine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=thrS PE=3 SV=1 75 706 1.0E-145
sp|B5EBX9|SYT_GEOBB Threonine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=thrS PE=3 SV=1 75 712 1.0E-145
sp|A5G0L2|SYT_ACICJ Threonine--tRNA ligase OS=Acidiphilium cryptum (strain JF-5) GN=thrS PE=3 SV=1 77 717 1.0E-145
sp|C1CFK0|SYT_STRZJ Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=thrS PE=3 SV=1 76 712 1.0E-145
sp|Q480A9|SYT_COLP3 Threonine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=thrS PE=3 SV=1 77 705 2.0E-145
sp|A2SH07|SYT_METPP Threonine--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=thrS PE=3 SV=1 76 694 2.0E-145
sp|Q5LTX8|SYT_RUEPO Threonine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=thrS PE=3 SV=1 75 710 2.0E-145
sp|Q1GFW2|SYT_RUEST Threonine--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=thrS PE=3 SV=1 75 728 2.0E-145
sp|C3MB49|SYT_RHISN Threonine--tRNA ligase OS=Rhizobium sp. (strain NGR234) GN=thrS PE=3 SV=1 76 740 2.0E-145
sp|A7N009|SYT_VIBCB Threonine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=thrS PE=3 SV=1 78 705 2.0E-145
sp|B3PNV4|SYT_RHIE6 Threonine--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=thrS PE=3 SV=1 74 727 2.0E-145
sp|Q8DT12|SYT_STRMU Threonine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=thrS PE=3 SV=1 76 713 3.0E-145
sp|Q9PIS3|SYT_CAMJE Threonine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=thrS PE=3 SV=1 107 719 3.0E-145
sp|Q8DNX8|SYT_STRR6 Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=thrS PE=3 SV=2 76 712 3.0E-145
sp|Q04JD7|SYT_STRP2 Threonine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=thrS PE=3 SV=1 76 712 3.0E-145
sp|A7HWJ3|SYT_PARL1 Threonine--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=thrS PE=3 SV=1 99 728 3.0E-145
sp|A9M375|SYT_NEIM0 Threonine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=thrS PE=3 SV=1 76 705 3.0E-145
sp|Q12BR3|SYT_POLSJ Threonine--tRNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=thrS PE=3 SV=1 76 694 3.0E-145
sp|A8H4U6|SYT_SHEPA Threonine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=thrS PE=3 SV=1 77 737 3.0E-145
sp|Q65TQ0|SYT_MANSM Threonine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=thrS PE=3 SV=1 78 743 4.0E-145
sp|B0BSM2|SYT_ACTPJ Threonine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=thrS PE=3 SV=1 78 735 4.0E-145
sp|B3H061|SYT_ACTP7 Threonine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=thrS PE=3 SV=1 78 735 4.0E-145
sp|B1XYZ3|SYT_LEPCP Threonine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=thrS PE=3 SV=1 76 708 4.0E-145
sp|C0Q647|SYT_SALPC Threonine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=thrS PE=3 SV=1 77 736 5.0E-145
sp|B0VKJ4|SYT_ACIBS Threonine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=thrS PE=3 SV=1 78 734 6.0E-145
sp|Q5FSP9|SYT_GLUOX Threonine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=thrS PE=3 SV=1 77 728 6.0E-145
sp|A3PBX1|SYT_PROM0 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=thrS PE=3 SV=1 78 703 6.0E-145
sp|A8GDQ5|SYT_SERP5 Threonine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=thrS PE=3 SV=1 77 735 7.0E-145
sp|A3MYU1|SYT_ACTP2 Threonine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=thrS PE=3 SV=1 78 735 9.0E-145
sp|A1VXT5|SYT_CAMJJ Threonine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=thrS PE=3 SV=1 107 719 9.0E-145
sp|B8ZM32|SYT_STRPJ Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=thrS PE=3 SV=1 76 712 9.0E-145
sp|A2BQ78|SYT_PROMS Threonine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=thrS PE=3 SV=1 78 703 9.0E-145
sp|Q6F860|SYT_ACIAD Threonine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=thrS PE=3 SV=1 78 734 1.0E-144
sp|Q6G3K1|SYT_BARHE Threonine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=thrS PE=3 SV=1 76 703 1.0E-144
sp|P57857|SYT_PASMU Threonine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=thrS PE=3 SV=1 78 743 1.0E-144
sp|Q31BT7|SYT_PROM9 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=thrS PE=3 SV=1 78 706 1.0E-144
sp|Q8UEL1|SYT_AGRFC Threonine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=thrS PE=3 SV=1 74 727 1.0E-144
sp|C1D0W2|SYT_DEIDV Threonine--tRNA ligase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=thrS PE=3 SV=1 78 705 1.0E-144
sp|A4G619|SYT_HERAR Threonine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=thrS PE=3 SV=1 76 705 2.0E-144
sp|Q5GXY0|SYT_XANOR Threonine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=thrS PE=3 SV=2 76 705 2.0E-144
sp|Q2P0Z5|SYT_XANOM Threonine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=thrS PE=3 SV=1 76 705 2.0E-144
sp|B3CMJ4|SYT_WOLPP Threonine--tRNA ligase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=thrS PE=3 SV=1 107 729 2.0E-144
sp|Q7MK65|SYT_VIBVY Threonine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=thrS PE=3 SV=2 78 705 2.0E-144
sp|C6BRH1|SYT_DESAD Threonine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=thrS PE=3 SV=1 101 708 2.0E-144
sp|B0TT20|SYT_SHEHH Threonine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=thrS PE=3 SV=1 77 737 3.0E-144
sp|Q5GSG4|SYT_WOLTR Threonine--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=thrS PE=3 SV=1 114 712 3.0E-144
sp|A8AWB7|SYT_STRGC Threonine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=thrS PE=3 SV=1 76 712 3.0E-144
sp|B9JWF4|SYT_AGRVS Threonine--tRNA ligase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=thrS PE=3 SV=1 74 727 3.0E-144
sp|Q87Q70|SYT_VIBPA Threonine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thrS PE=3 SV=1 78 705 3.0E-144
sp|Q8DA13|SYT_VIBVU Threonine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=thrS PE=3 SV=1 78 705 4.0E-144
sp|Q9JVA3|SYT_NEIMA Threonine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=thrS PE=3 SV=1 76 705 4.0E-144
sp|A9BAX2|SYT_PROM4 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=thrS PE=3 SV=1 78 739 6.0E-144
sp|A6VYI1|SYT_MARMS Threonine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=thrS PE=3 SV=1 77 705 7.0E-144
sp|A1B0M2|SYT_PARDP Threonine--tRNA ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=thrS PE=3 SV=1 75 714 7.0E-144
sp|Q5F9U4|SYT_NEIG1 Threonine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=thrS PE=3 SV=1 76 705 7.0E-144
sp|Q2K859|SYT_RHIEC Threonine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=thrS PE=3 SV=1 74 726 8.0E-144
sp|B0U5E3|SYT_XYLFM Threonine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=thrS PE=3 SV=1 76 717 9.0E-144
sp|Q47CM4|SYT_DECAR Threonine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=thrS PE=3 SV=1 78 708 9.0E-144
sp|Q83C10|SYT_COXBU Threonine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=thrS PE=3 SV=1 77 712 9.0E-144
sp|Q4FNH9|SYT_PELUB Threonine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=thrS PE=3 SV=1 78 728 9.0E-144
sp|A7H1S0|SYT_CAMJD Threonine--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=thrS PE=3 SV=1 107 719 9.0E-144
sp|B8CME8|SYT_SHEPW Threonine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=thrS PE=3 SV=1 77 737 1.0E-143
sp|B8J4E4|SYT_DESDA Threonine--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=thrS PE=3 SV=1 83 719 1.0E-143
sp|Q9PFE2|SYT_XYLFA Threonine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=thrS PE=3 SV=1 76 717 1.0E-143
sp|C5BSQ1|SYT_TERTT Threonine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=thrS PE=3 SV=1 77 706 1.0E-143
sp|C3JZN7|SYT_PSEFS Threonine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=thrS PE=3 SV=1 77 733 1.0E-143
sp|B1XV14|SYT_POLNS Threonine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=thrS PE=3 SV=1 76 705 2.0E-143
sp|Q8P7Z2|SYT_XANCP Threonine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=thrS PE=3 SV=1 76 705 2.0E-143
sp|B0RRG9|SYT_XANCB Threonine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=thrS PE=3 SV=1 76 705 2.0E-143
sp|Q4UW57|SYT_XANC8 Threonine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=thrS PE=3 SV=1 76 705 2.0E-143
sp|Q6D4G8|SYT_PECAS Threonine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thrS PE=3 SV=1 77 705 2.0E-143
sp|A1JMJ9|SYT_YERE8 Threonine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=thrS PE=3 SV=1 77 705 2.0E-143
sp|B5ZQK2|SYT_RHILW Threonine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=thrS PE=3 SV=1 74 714 2.0E-143
sp|Q6FZZ7|SYT_BARQU Threonine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=thrS PE=3 SV=1 76 703 2.0E-143
sp|A3CP56|SYT_STRSV Threonine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=thrS PE=3 SV=1 76 736 3.0E-143
sp|B1JJ17|SYT_YERPY Threonine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=thrS PE=3 SV=1 77 705 3.0E-143
sp|Q669Z0|SYT_YERPS Threonine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=thrS PE=3 SV=1 77 705 3.0E-143
sp|A4TIL1|SYT_YERPP Threonine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=thrS PE=3 SV=1 77 705 3.0E-143
sp|Q1CIG3|SYT_YERPN Threonine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=thrS PE=3 SV=1 77 705 3.0E-143
sp|A9R0A8|SYT_YERPG Threonine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=thrS PE=3 SV=1 77 705 3.0E-143
sp|Q8ZDW5|SYT_YERPE Threonine--tRNA ligase OS=Yersinia pestis GN=thrS PE=3 SV=1 77 705 3.0E-143
sp|B2K668|SYT_YERPB Threonine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=thrS PE=3 SV=1 77 705 3.0E-143
sp|Q1C728|SYT_YERPA Threonine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=thrS PE=3 SV=1 77 705 3.0E-143
sp|A7FHG1|SYT_YERP3 Threonine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=thrS PE=3 SV=1 77 705 3.0E-143
sp|A0L4J6|SYT_MAGMM Threonine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=thrS PE=3 SV=1 76 744 3.0E-143
sp|Q87AB2|SYT_XYLFT Threonine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=thrS PE=3 SV=1 76 717 3.0E-143
sp|B2I9P8|SYT_XYLF2 Threonine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=thrS PE=3 SV=1 76 717 3.0E-143
sp|Q1GZR7|SYT_METFK Threonine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=thrS PE=3 SV=1 77 726 3.0E-143
sp|B6YQ95|SYT_AZOPC Threonine--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=thrS PE=3 SV=1 76 703 4.0E-143
sp|A4Y706|SYT_SHEPC Threonine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=thrS PE=3 SV=1 77 736 5.0E-143
sp|A1RJI3|SYT_SHESW Threonine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=thrS PE=3 SV=1 77 736 6.0E-143
sp|C4LFH3|SYT_TOLAT Threonine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=thrS PE=3 SV=1 77 705 6.0E-143
sp|A6VNZ2|SYT_ACTSZ Threonine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=thrS PE=3 SV=1 78 705 6.0E-143
sp|Q0ADN4|SYT_NITEC Threonine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=thrS PE=3 SV=1 77 708 6.0E-143
sp|A2BVR0|SYT_PROM5 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=thrS PE=3 SV=1 78 706 6.0E-143
sp|Q2GBX1|SYT_NOVAD Threonine--tRNA ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=thrS PE=3 SV=1 74 726 9.0E-143
sp|A8G3W3|SYT_PROM2 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=thrS PE=3 SV=1 78 709 1.0E-142
sp|A1K4E1|SYT_AZOSB Threonine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=thrS PE=3 SV=1 78 708 1.0E-142
sp|Q7VJ09|SYT_HELHP Threonine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=thrS PE=3 SV=1 119 709 1.0E-142
sp|B2RJD6|SYT_PORG3 Threonine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=thrS PE=3 SV=1 76 705 1.0E-142
sp|Q9Z7A0|SYT_CHLPN Threonine--tRNA ligase OS=Chlamydia pneumoniae GN=thrS PE=3 SV=1 93 708 2.0E-142
sp|Q8KAN0|SYT_CHLTE Threonine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=thrS PE=3 SV=1 73 717 2.0E-142
sp|C6DFY6|SYT_PECCP Threonine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=thrS PE=3 SV=1 77 705 2.0E-142
sp|Q082E1|SYT_SHEFN Threonine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=thrS PE=3 SV=1 78 736 2.0E-142
sp|A8LQX9|SYT_DINSH Threonine--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=thrS PE=3 SV=1 75 714 2.0E-142
sp|Q7N3P6|SYT_PHOLL Threonine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=thrS PE=3 SV=1 77 705 2.0E-142
sp|Q2L2M5|SYT_BORA1 Threonine--tRNA ligase OS=Bordetella avium (strain 197N) GN=thrS PE=3 SV=1 76 703 2.0E-142
sp|A3QEK0|SYT_SHELP Threonine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=thrS PE=3 SV=1 77 706 2.0E-142
sp|Q92QB0|SYT_RHIME Threonine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=thrS PE=3 SV=1 76 726 2.0E-142
sp|A1TR39|SYT_ACIAC Threonine--tRNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=thrS PE=3 SV=1 76 694 2.0E-142
sp|A0KKP9|SYT_AERHH Threonine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=thrS PE=3 SV=1 78 736 2.0E-142
sp|Q8EER9|SYT_SHEON Threonine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=thrS PE=3 SV=1 77 706 3.0E-142
sp|Q8PJE1|SYT_XANAC Threonine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=thrS PE=3 SV=1 76 705 3.0E-142
sp|B3CSS5|SYT_ORITI Threonine--tRNA ligase OS=Orientia tsutsugamushi (strain Ikeda) GN=thrS PE=3 SV=1 76 730 3.0E-142
sp|Q2YBS6|SYT_NITMU Threonine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=thrS PE=3 SV=1 77 705 5.0E-142
sp|A4VW43|SYT_STRSY Threonine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=thrS PE=3 SV=1 76 727 5.0E-142
sp|A4W2F0|SYT_STRS2 Threonine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=thrS PE=3 SV=1 76 727 5.0E-142
sp|Q3BRT7|SYT_XANC5 Threonine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=thrS PE=3 SV=1 76 705 5.0E-142
sp|A9HFP5|SYT_GLUDA Threonine--tRNA ligase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=thrS PE=3 SV=1 77 704 6.0E-142
sp|A1SWU5|SYT_PSYIN Threonine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=thrS PE=3 SV=1 78 705 7.0E-142
sp|C1DF42|SYT_AZOVD Threonine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=thrS PE=3 SV=1 78 706 8.0E-142
sp|B4SQH4|SYT_STRM5 Threonine--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=thrS PE=3 SV=1 76 712 1.0E-141
sp|A9IRH6|SYT_BORPD Threonine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=thrS PE=3 SV=1 76 704 1.0E-141
sp|B2VEM1|SYT_ERWT9 Threonine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=thrS PE=3 SV=1 77 743 1.0E-141
sp|Q2WAI1|SYT_MAGSA Threonine--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=thrS PE=3 SV=1 76 726 1.0E-141
sp|A6WNH2|SYT_SHEB8 Threonine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=thrS PE=3 SV=1 77 736 1.0E-141
sp|A3D4I2|SYT_SHEB5 Threonine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=thrS PE=3 SV=1 77 736 1.0E-141
sp|B8EES6|SYT_SHEB2 Threonine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=thrS PE=3 SV=1 77 736 1.0E-141
sp|Q2GEB1|SYT_NEOSM Threonine--tRNA ligase OS=Neorickettsia sennetsu (strain Miyayama) GN=thrS PE=3 SV=1 94 723 1.0E-141
sp|A9L2Q9|SYT_SHEB9 Threonine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=thrS PE=3 SV=1 77 736 2.0E-141
sp|Q0BRP0|SYT_GRABC Threonine--tRNA ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=thrS PE=3 SV=1 77 726 2.0E-141
sp|A5CD12|SYT_ORITB Threonine--tRNA ligase OS=Orientia tsutsugamushi (strain Boryong) GN=thrS PE=3 SV=1 76 730 2.0E-141
sp|Q7VBM8|SYT_PROMA Threonine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=thrS PE=3 SV=1 78 731 2.0E-141
sp|Q7MVQ5|SYT_PORGI Threonine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=thrS PE=3 SV=1 76 705 2.0E-141
sp|Q1MGA7|SYT_RHIL3 Threonine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=thrS PE=3 SV=1 74 726 3.0E-141
sp|A7GVZ2|SYT_CAMC5 Threonine--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=thrS PE=3 SV=1 107 721 3.0E-141
sp|Q7VKR9|SYT_HAEDU Threonine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=thrS PE=3 SV=1 78 705 3.0E-141
sp|Q7V287|SYT_PROMP Threonine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=thrS PE=3 SV=1 78 709 3.0E-141
sp|Q0HIT9|SYT_SHESM Threonine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=thrS PE=3 SV=1 77 706 4.0E-141
sp|A0KWV4|SYT_SHESA Threonine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=thrS PE=3 SV=1 77 706 4.0E-141
sp|Q0HV45|SYT_SHESR Threonine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=thrS PE=3 SV=1 77 706 4.0E-141
sp|A5UBX5|SYT_HAEIE Threonine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=thrS PE=3 SV=1 78 705 4.0E-141
sp|Q3KEY2|SYT_PSEPF Threonine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=thrS PE=3 SV=1 77 733 8.0E-141
sp|B0UU42|SYT_HISS2 Threonine--tRNA ligase OS=Histophilus somni (strain 2336) GN=thrS PE=3 SV=1 78 719 9.0E-141
sp|B8F5H9|SYT_HAEPS Threonine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=thrS PE=3 SV=1 78 743 9.0E-141
sp|Q03LP1|SYT_STRTD Threonine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=thrS PE=3 SV=1 76 727 1.0E-140
sp|Q5M5B9|SYT_STRT2 Threonine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=thrS PE=3 SV=1 76 727 1.0E-140
sp|Q5M0T3|SYT_STRT1 Threonine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=thrS PE=3 SV=1 76 727 1.0E-140
sp|Q57D65|SYT_BRUAB Threonine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=thrS PE=3 SV=1 76 732 1.0E-140
sp|Q2YQ07|SYT_BRUA2 Threonine--tRNA ligase OS=Brucella abortus (strain 2308) GN=thrS PE=3 SV=1 76 732 1.0E-140
sp|B2S5S6|SYT_BRUA1 Threonine--tRNA ligase OS=Brucella abortus (strain S19) GN=thrS PE=3 SV=1 76 732 1.0E-140
sp|Q4QK77|SYT_HAEI8 Threonine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=thrS PE=3 SV=1 78 705 1.0E-140
sp|Q0I3M2|SYT_HAES1 Threonine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=thrS PE=3 SV=1 78 719 1.0E-140
sp|Q3SK34|SYT_THIDA Threonine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=thrS PE=3 SV=1 76 714 1.0E-140
sp|P56881|SYT_THET8 Threonine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=thrS PE=1 SV=1 76 739 2.0E-140
sp|B1KG61|SYT_SHEWM Threonine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=thrS PE=3 SV=1 77 706 2.0E-140
sp|B2FN79|SYT_STRMK Threonine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=thrS PE=3 SV=1 76 712 2.0E-140
sp|Q8YH89|SYT_BRUME Threonine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=thrS PE=3 SV=1 76 732 3.0E-140
sp|A1S6G4|SYT_SHEAM Threonine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=thrS PE=3 SV=1 77 706 3.0E-140
sp|A1AWT6|SYT_RUTMC Threonine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=thrS PE=3 SV=1 78 705 4.0E-140
sp|Q5NPH1|SYT_ZYMMO Threonine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=thrS PE=3 SV=1 74 719 4.0E-140
sp|A7ZAZ7|SYT_CAMC1 Threonine--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=thrS PE=3 SV=1 111 721 4.0E-140
sp|Q72HH1|SYT_THET2 Threonine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=thrS PE=3 SV=1 76 739 4.0E-140
sp|A8FV56|SYT_SHESH Threonine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=thrS PE=3 SV=1 77 706 4.0E-140
sp|Q8G0L8|SYT_BRUSU Threonine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=thrS PE=3 SV=1 76 732 4.0E-140
sp|B0CGM0|SYT_BRUSI Threonine--tRNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=thrS PE=3 SV=1 76 732 4.0E-140
sp|A9M582|SYT_BRUC2 Threonine--tRNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=thrS PE=3 SV=1 76 732 4.0E-140
sp|Q1IY82|SYT_DEIGD Threonine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=thrS PE=3 SV=1 78 705 5.0E-140
sp|C0RJ44|SYT_BRUMB Threonine--tRNA ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=thrS PE=3 SV=1 76 732 5.0E-140
sp|A1W8I6|SYT_ACISJ Threonine--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=thrS PE=3 SV=1 76 694 6.0E-140
sp|C4K776|SYT_HAMD5 Threonine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=thrS PE=3 SV=1 77 704 7.0E-140
sp|Q9RSP3|SYT_DEIRA Threonine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=thrS PE=3 SV=1 78 713 7.0E-140
sp|Q12NI7|SYT_SHEDO Threonine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=thrS PE=3 SV=1 78 706 8.0E-140
sp|Q21KE0|SYT_SACD2 Threonine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=thrS PE=3 SV=1 77 705 8.0E-140
sp|A4SCK4|SYT_CHLPM Threonine--tRNA ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=thrS PE=3 SV=1 76 703 8.0E-140
sp|A6SY30|SYT_JANMA Threonine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=thrS PE=3 SV=1 76 705 1.0E-139
sp|P43014|SYT_HAEIN Threonine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thrS PE=3 SV=1 78 705 1.0E-139
sp|B9L5U7|SYT_NAUPA Threonine--tRNA ligase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=thrS PE=3 SV=1 107 723 2.0E-139
sp|A9C3D4|SYT_DELAS Threonine--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=thrS PE=3 SV=1 76 694 2.0E-139
sp|A6QD00|SYT_SULNB Threonine--tRNA ligase OS=Sulfurovum sp. (strain NBC37-1) GN=thrS PE=3 SV=1 107 705 2.0E-139
sp|B9MHX8|SYT_ACIET Threonine--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=thrS PE=3 SV=1 76 694 2.0E-139
sp|A5UEK1|SYT_HAEIG Threonine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=thrS PE=3 SV=1 78 705 3.0E-139
sp|C4XL11|SYT_DESMR Threonine--tRNA ligase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=thrS PE=3 SV=1 84 713 3.0E-139
sp|A4SMA4|SYT_AERS4 Threonine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=thrS PE=3 SV=1 78 736 4.0E-139
sp|Q7VY64|SYT_BORPE Threonine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=thrS PE=3 SV=1 76 704 7.0E-139
sp|Q7W912|SYT_BORPA Threonine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=thrS PE=3 SV=1 76 704 7.0E-139
sp|Q7WKF7|SYT_BORBR Threonine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=thrS PE=3 SV=1 76 704 7.0E-139
sp|Q49YB4|SYT_STAS1 Threonine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=thrS PE=3 SV=1 74 717 8.0E-139
sp|A0Q762|SYT_FRATN Threonine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=thrS PE=3 SV=1 76 703 1.0E-138
sp|Q2FXP7|SYT_STAA8 Threonine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=thrS PE=3 SV=1 74 717 1.0E-138
sp|C1DDA6|SYT_LARHH Threonine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=thrS PE=3 SV=1 77 726 3.0E-138
sp|Q8NW68|SYT_STAAW Threonine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=thrS PE=1 SV=1 74 717 4.0E-138
sp|A8Z2J8|SYT_STAAT Threonine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=thrS PE=3 SV=1 74 717 4.0E-138
sp|Q6G8P3|SYT_STAAS Threonine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=thrS PE=3 SV=1 74 717 4.0E-138
sp|Q6GG23|SYT_STAAR Threonine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=thrS PE=3 SV=1 74 717 4.0E-138
sp|A6QHL6|SYT_STAAE Threonine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=thrS PE=3 SV=1 74 717 4.0E-138
sp|Q5HF90|SYT_STAAC Threonine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=thrS PE=3 SV=1 74 717 4.0E-138
sp|A5ITK7|SYT_STAA9 Threonine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=thrS PE=3 SV=1 74 717 4.0E-138
sp|Q2FG54|SYT_STAA3 Threonine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=thrS PE=3 SV=1 74 717 4.0E-138
sp|A6U2F0|SYT_STAA2 Threonine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=thrS PE=3 SV=1 74 717 4.0E-138
sp|Q5P7X5|SYT_AROAE Threonine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=thrS PE=3 SV=1 78 708 7.0E-138
sp|Q2NT31|SYT_SODGM Threonine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=thrS PE=3 SV=1 77 743 9.0E-138
sp|A4IX68|SYT_FRATW Threonine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=thrS PE=3 SV=1 76 703 1.0E-137
sp|Q5NGL8|SYT_FRATT Threonine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=thrS PE=3 SV=1 76 703 1.0E-137
sp|Q14I20|SYT_FRAT1 Threonine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=thrS PE=3 SV=1 76 703 1.0E-137
sp|B3QUU7|SYT_CHLT3 Threonine--tRNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=thrS PE=3 SV=1 74 726 1.0E-137
sp|Q2YTA7|SYT_STAAB Threonine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=thrS PE=3 SV=1 74 717 1.0E-137
sp|B4S3D2|SYT_PROA2 Threonine--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=thrS PE=3 SV=1 80 716 1.0E-137
sp|B2SGS3|SYT_FRATM Threonine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=thrS PE=3 SV=1 76 703 1.0E-137
sp|O67583|SYT_AQUAE Threonine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=thrS PE=3 SV=1 115 712 2.0E-137
sp|B9KH76|SYT_ANAMF Threonine--tRNA ligase OS=Anaplasma marginale (strain Florida) GN=thrS PE=3 SV=1 93 703 2.0E-137
sp|Q1QWK7|SYT_CHRSD Threonine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=thrS PE=3 SV=1 78 712 4.0E-137
sp|Q5P9F6|SYT_ANAMM Threonine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=thrS PE=3 SV=1 93 703 4.0E-137
sp|C5B846|SYT_EDWI9 Threonine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=thrS PE=3 SV=1 77 705 4.0E-137
sp|P67585|SYT_STAAN Threonine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=thrS PE=1 SV=1 74 717 6.0E-137
sp|P67584|SYT_STAAM Threonine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thrS PE=3 SV=1 74 717 6.0E-137
sp|A7X3A6|SYT_STAA1 Threonine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=thrS PE=3 SV=1 74 717 6.0E-137
sp|B3EKG9|SYT_CHLPB Threonine--tRNA ligase OS=Chlorobium phaeobacteroides (strain BS1) GN=thrS PE=3 SV=1 76 731 8.0E-137
sp|Q1GVA9|SYT_SPHAL Threonine--tRNA ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=thrS PE=3 SV=1 76 726 1.0E-136
sp|Q3ZXB5|SYT_DEHMC Threonine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=thrS PE=3 SV=1 140 705 1.0E-136
sp|Q73NR2|SYT_TREDE Threonine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=thrS PE=3 SV=1 148 705 2.0E-136
sp|Q0BL41|SYT_FRATO Threonine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=thrS PE=3 SV=1 76 703 2.0E-136
sp|A5CWF9|SYT_VESOH Threonine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=thrS PE=3 SV=1 78 705 2.0E-136
sp|Q2A2J0|SYT_FRATH Threonine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=thrS PE=3 SV=1 76 703 2.0E-136
sp|A7NDB6|SYT_FRATF Threonine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=thrS PE=3 SV=1 76 703 2.0E-136
sp|Q18H54|SYT_HALWD Threonine--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=thrS PE=3 SV=1 75 739 3.0E-136
sp|Q168U9|SYT_ROSDO Threonine--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=thrS PE=3 SV=1 75 710 4.0E-136
sp|A5FRB3|SYT_DEHMB Threonine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=thrS PE=3 SV=1 140 705 8.0E-136
sp|B7GGN9|SYT_ANOFW Threonine--tRNA ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=thrS PE=3 SV=1 76 728 9.0E-136
sp|Q2GI92|SYT_EHRCR Threonine--tRNA ligase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=thrS PE=3 SV=1 84 727 1.0E-135
sp|Q9HP27|SYT_HALSA Threonine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thrS PE=3 SV=2 76 739 1.0E-135
sp|B0R6G6|SYT_HALS3 Threonine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=thrS PE=3 SV=1 76 739 1.0E-135
sp|Q9K866|SYT_BACHD Threonine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thrS PE=3 SV=1 76 728 1.0E-135
sp|Q3Z8G2|SYT_DEHM1 Threonine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=thrS PE=3 SV=1 140 705 2.0E-135
sp|B4SB93|SYT_PELPB Threonine--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=thrS PE=3 SV=1 76 703 2.0E-135
sp|Q7V8D2|SYT_PROMM Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=thrS PE=3 SV=1 78 723 2.0E-135
sp|Q3YQP0|SYT_EHRCJ Threonine--tRNA ligase OS=Ehrlichia canis (strain Jake) GN=thrS PE=3 SV=1 84 727 3.0E-135
sp|B2URV1|SYT_HELPS Threonine--tRNA ligase OS=Helicobacter pylori (strain Shi470) GN=thrS PE=3 SV=1 144 723 4.0E-135
sp|Q8EPF3|SYT_OCEIH Threonine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=thrS PE=3 SV=1 75 712 4.0E-135
sp|B6JPM2|SYT_HELP2 Threonine--tRNA ligase OS=Helicobacter pylori (strain P12) GN=thrS PE=3 SV=1 144 723 6.0E-135
sp|Q5KWD2|SYT_GEOKA Threonine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=thrS PE=3 SV=1 76 714 6.0E-135
sp|Q1CV33|SYT_HELPH Threonine--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=thrS PE=3 SV=1 144 723 9.0E-135
sp|B5Z9Q1|SYT_HELPG Threonine--tRNA ligase OS=Helicobacter pylori (strain G27) GN=thrS PE=3 SV=1 144 723 2.0E-134
sp|A2CAU4|SYT_PROM3 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=thrS PE=3 SV=1 78 706 2.0E-134
sp|Q3IRE7|SYT_NATPD Threonine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=thrS PE=3 SV=1 75 742 2.0E-134
sp|B4RE95|SYT_PHEZH Threonine--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=thrS PE=3 SV=1 76 704 2.0E-134
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0005524 ATP binding Yes
GO:0043039 tRNA aminoacylation Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0006520 cellular amino acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1264
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|254 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2264
Ophiocordyceps camponoti-floridani Ophcf2|04358
Ophiocordyceps camponoti-rufipedis Ophun1|3038
Ophiocordyceps kimflemingae Ophio5|3158
Ophiocordyceps subramaniannii Hirsu2|10506

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|254
MSSDQAAVSQGAQDASVQSLPSRPAKQAKDKGAKSSKSAGLELPTHPEFIQHRLDLFNKLKARQDAEIAAKPREE
IAIALPNGQEHRGTSWETTPAEVARAISKSLLERTVISRVDGELWDLTRPLEKSCKLELIDFDNIEGKKVFWHSS
AHILGEAAERRFGCYLCNGPPTEDPPGFYYDMAKMEGAVIADEDKKALETLSNSIIKEKQPFERLEMTKSELLEM
FRYSKYKEYFINQRVPEGTKSTVYRCGPLIDLCRGPHVPHTGNIKAFSVLRNSAAYWLGDSKNESVQRIAGISFP
DKKQLEEYKTFLAEAAKRNHRKIGQDQKLFFWDEMSPGSTFWLPHGTRIYNALMDLMKNEYHKRGFVEVMSPNMY
KADLWKVSGHWNHYEENMFTFDVEKEKFGLKPMNCPGHCKIFAHSDVTYRELPWRMADFGVLHRNEFSGALSGLT
RVRRFQQDDAHIFCTVDQIRQEIEGAFDFLYGVYGLFGFKFKLKLSTRPEKYIGEIAMWDMAEAKLKEALDSFTA
KIGAQWEENAGDGAFYGPKIDITVYDALRRDHQCGTIQLDFNLPQRFKLRYVAAKGDSGAATTGDDADLPIGYAR
PVMIHRAVLGSFERMIGILTEHFGGKWPFWLSPRQVLVVPVMPGVNDYAHEVQKLLHDHGLHADADVSSNTFQKK
IRTGQLEQFNFIFVVGAEEAKSRTVNIRNRDDQSTQSKGELVPLSEALEHLVKLKAARRLENKFQGEETA*
Coding >OphauG2|254
ATGTCGTCCGACCAAGCCGCAGTGTCTCAAGGTGCGCAAGACGCCTCGGTCCAGAGCCTTCCCTCTCGGCCCGCA
AAACAGGCCAAGGACAAGGGCGCAAAAAGCTCCAAGAGTGCGGGGCTCGAGCTGCCCACGCACCCTGAATTCATA
CAGCATCGCCTCGACTTATTCAACAAGCTAAAGGCGCGACAAGACGCCGAGATTGCTGCCAAGCCACGTGAGGAA
ATCGCCATTGCGCTACCCAATGGCCAAGAACACAGGGGAACTTCTTGGGAGACGACGCCTGCAGAGGTTGCCAGG
GCAATCTCCAAGTCACTACTCGAACGCACCGTAATCTCTCGTGTTGACGGGGAGCTGTGGGATCTCACCCGGCCA
CTTGAAAAGAGCTGCAAGCTCGAATTGATAGATTTCGACAACATTGAAGGCAAAAAGGTGTTTTGGCACTCTTCA
GCTCACATATTGGGGGAAGCTGCGGAGCGACGATTCGGCTGTTACTTATGCAATGGTCCTCCGACCGAAGACCCC
CCTGGCTTCTACTACGACATGGCAAAAATGGAAGGCGCTGTCATTGCCGACGAGGACAAGAAGGCACTGGAAACA
CTGTCCAATTCAATCATCAAGGAGAAGCAGCCCTTTGAGCGCCTTGAGATGACCAAAAGCGAACTCCTCGAGATG
TTCAGGTACAGCAAATACAAAGAATACTTTATCAACCAGCGTGTCCCCGAAGGGACCAAGAGCACCGTCTATCGA
TGCGGACCTCTTATCGATTTGTGCCGGGGACCGCACGTTCCTCATACGGGCAATATCAAGGCCTTTTCCGTGTTA
AGGAATTCGGCTGCCTACTGGCTTGGCGACAGCAAGAACGAGTCCGTTCAGCGTATTGCTGGCATCTCATTTCCC
GACAAGAAGCAACTCGAGGAGTACAAGACGTTCTTGGCAGAGGCGGCCAAACGCAATCATCGCAAAATTGGCCAA
GATCAAAAGTTGTTTTTCTGGGACGAAATGTCTCCAGGTTCAACCTTTTGGTTGCCCCATGGCACGAGAATCTAT
AACGCTCTCATGGATTTGATGAAGAATGAGTATCACAAACGCGGCTTTGTGGAAGTCATGTCTCCCAACATGTAC
AAAGCAGACCTTTGGAAAGTGTCGGGTCATTGGAATCACTATGAGGAGAACATGTTTACCTTTGACGTGGAGAAG
GAGAAGTTTGGATTGAAACCCATGAATTGTCCCGGCCACTGCAAAATATTTGCGCACTCAGACGTTACCTATAGG
GAGCTGCCGTGGCGAATGGCCGACTTTGGTGTCCTTCATCGCAACGAGTTCTCGGGTGCTCTTTCAGGACTTACT
CGCGTGCGTAGGTTCCAACAGGATGACGCTCATATCTTCTGTACTGTCGATCAGATTCGACAAGAAATTGAAGGC
GCCTTCGACTTTCTATACGGGGTCTATGGACTCTTTGGCTTCAAATTCAAGCTCAAGCTCTCGACTCGTCCCGAA
AAGTATATTGGCGAAATTGCCATGTGGGACATGGCTGAGGCTAAACTCAAGGAAGCATTGGATTCGTTTACTGCA
AAGATTGGCGCCCAGTGGGAGGAAAACGCTGGCGATGGTGCTTTCTACGGTCCCAAGATTGACATCACTGTGTAT
GACGCCCTGAGGCGTGACCATCAGTGCGGCACCATCCAGCTTGATTTTAATCTGCCTCAGCGGTTCAAGCTTCGA
TACGTGGCGGCCAAGGGTGACAGTGGAGCTGCAACGACGGGTGACGATGCCGACCTGCCTATTGGGTACGCCCGC
CCGGTAATGATACACCGCGCAGTGCTAGGAAGCTTTGAAAGAATGATTGGCATTCTCACAGAACACTTTGGCGGC
AAGTGGCCATTTTGGCTCAGTCCTCGGCAGGTTCTTGTGGTACCGGTGATGCCGGGCGTCAATGACTATGCCCAT
GAGGTGCAAAAACTCTTACACGATCACGGACTGCATGCAGATGCGGATGTGAGCAGCAACACATTCCAGAAGAAG
ATTCGCACGGGACAGCTGGAACAGTTCAATTTCATATTTGTTGTTGGAGCGGAGGAGGCCAAGTCACGAACAGTT
AACATTCGGAATCGCGATGACCAGAGCACGCAGAGCAAAGGCGAGCTGGTACCACTATCGGAAGCTCTAGAGCAC
CTCGTCAAACTCAAGGCAGCAAGGCGACTGGAGAACAAGTTTCAAGGCGAGGAGACTGCATAA
Transcript >OphauG2|254
ATGTCGTCCGACCAAGCCGCAGTGTCTCAAGGTGCGCAAGACGCCTCGGTCCAGAGCCTTCCCTCTCGGCCCGCA
AAACAGGCCAAGGACAAGGGCGCAAAAAGCTCCAAGAGTGCGGGGCTCGAGCTGCCCACGCACCCTGAATTCATA
CAGCATCGCCTCGACTTATTCAACAAGCTAAAGGCGCGACAAGACGCCGAGATTGCTGCCAAGCCACGTGAGGAA
ATCGCCATTGCGCTACCCAATGGCCAAGAACACAGGGGAACTTCTTGGGAGACGACGCCTGCAGAGGTTGCCAGG
GCAATCTCCAAGTCACTACTCGAACGCACCGTAATCTCTCGTGTTGACGGGGAGCTGTGGGATCTCACCCGGCCA
CTTGAAAAGAGCTGCAAGCTCGAATTGATAGATTTCGACAACATTGAAGGCAAAAAGGTGTTTTGGCACTCTTCA
GCTCACATATTGGGGGAAGCTGCGGAGCGACGATTCGGCTGTTACTTATGCAATGGTCCTCCGACCGAAGACCCC
CCTGGCTTCTACTACGACATGGCAAAAATGGAAGGCGCTGTCATTGCCGACGAGGACAAGAAGGCACTGGAAACA
CTGTCCAATTCAATCATCAAGGAGAAGCAGCCCTTTGAGCGCCTTGAGATGACCAAAAGCGAACTCCTCGAGATG
TTCAGGTACAGCAAATACAAAGAATACTTTATCAACCAGCGTGTCCCCGAAGGGACCAAGAGCACCGTCTATCGA
TGCGGACCTCTTATCGATTTGTGCCGGGGACCGCACGTTCCTCATACGGGCAATATCAAGGCCTTTTCCGTGTTA
AGGAATTCGGCTGCCTACTGGCTTGGCGACAGCAAGAACGAGTCCGTTCAGCGTATTGCTGGCATCTCATTTCCC
GACAAGAAGCAACTCGAGGAGTACAAGACGTTCTTGGCAGAGGCGGCCAAACGCAATCATCGCAAAATTGGCCAA
GATCAAAAGTTGTTTTTCTGGGACGAAATGTCTCCAGGTTCAACCTTTTGGTTGCCCCATGGCACGAGAATCTAT
AACGCTCTCATGGATTTGATGAAGAATGAGTATCACAAACGCGGCTTTGTGGAAGTCATGTCTCCCAACATGTAC
AAAGCAGACCTTTGGAAAGTGTCGGGTCATTGGAATCACTATGAGGAGAACATGTTTACCTTTGACGTGGAGAAG
GAGAAGTTTGGATTGAAACCCATGAATTGTCCCGGCCACTGCAAAATATTTGCGCACTCAGACGTTACCTATAGG
GAGCTGCCGTGGCGAATGGCCGACTTTGGTGTCCTTCATCGCAACGAGTTCTCGGGTGCTCTTTCAGGACTTACT
CGCGTGCGTAGGTTCCAACAGGATGACGCTCATATCTTCTGTACTGTCGATCAGATTCGACAAGAAATTGAAGGC
GCCTTCGACTTTCTATACGGGGTCTATGGACTCTTTGGCTTCAAATTCAAGCTCAAGCTCTCGACTCGTCCCGAA
AAGTATATTGGCGAAATTGCCATGTGGGACATGGCTGAGGCTAAACTCAAGGAAGCATTGGATTCGTTTACTGCA
AAGATTGGCGCCCAGTGGGAGGAAAACGCTGGCGATGGTGCTTTCTACGGTCCCAAGATTGACATCACTGTGTAT
GACGCCCTGAGGCGTGACCATCAGTGCGGCACCATCCAGCTTGATTTTAATCTGCCTCAGCGGTTCAAGCTTCGA
TACGTGGCGGCCAAGGGTGACAGTGGAGCTGCAACGACGGGTGACGATGCCGACCTGCCTATTGGGTACGCCCGC
CCGGTAATGATACACCGCGCAGTGCTAGGAAGCTTTGAAAGAATGATTGGCATTCTCACAGAACACTTTGGCGGC
AAGTGGCCATTTTGGCTCAGTCCTCGGCAGGTTCTTGTGGTACCGGTGATGCCGGGCGTCAATGACTATGCCCAT
GAGGTGCAAAAACTCTTACACGATCACGGACTGCATGCAGATGCGGATGTGAGCAGCAACACATTCCAGAAGAAG
ATTCGCACGGGACAGCTGGAACAGTTCAATTTCATATTTGTTGTTGGAGCGGAGGAGGCCAAGTCACGAACAGTT
AACATTCGGAATCGCGATGACCAGAGCACGCAGAGCAAAGGCGAGCTGGTACCACTATCGGAAGCTCTAGAGCAC
CTCGTCAAACTCAAGGCAGCAAGGCGACTGGAGAACAAGTTTCAAGGCGAGGAGACTGCATAA
Gene >OphauG2|254
ATGTCGTCCGACCAAGCCGCAGTGTCTCAAGGTGCGCAAGACGCCTCGGTCCAGAGCCTTCCCTCTCGGCCCGCA
AAACAGGCCAAGGACAAGGGCGCAAAAAGCTCCAAGAGTGCGGGGCTCGAGGTGAGTGTCAAGAGAAGTCATGGA
CAATGCCTCTTGGCTAATCATAACATGATAGCTGCCCACGCACCCTGAATTCATACAGCATCGCCTCGACTTATT
CAACAAGCTAAAGGCGCGACAAGACGCCGAGATTGCTGGTGCGTTCTGACATGGGGTACAAGCCGCTTTGGTTTG
TTGGACTGTTGCACTCACATTCTTAAAGCCAAGCCACGTGAGGAAATCGCCATTGCGCTACCCAATGGCCAAGAA
CACAGGGGAACTTCTTGGGAGACGACGCCTGCAGAGGTTGCCAGGGCAATCTCCAAGTCACTACTCGAACGCACC
GTAATCTCTCGTGTTGACGGGGAGCTGTGGGATCTCACCCGGCCACTTGAAAAGAGCTGCAAGCTCGAATTGATA
GATTTCGACAACATTGAAGGTAGAATCCATGCCGAAATGTACTCTTTTTCAACTCGACTCACTGTGTCCATAGGC
AAAAAGGTGTTTTGGCACTCTTCAGCTCACATATTGGGGGAAGCTGCGGAGCGACGATTCGGCTGTTACTTATGC
AATGGTCCTCCGACCGAAGACCCCCCTGGCTTCTACTACGACATGGCAAAAATGGAAGGGTGCGTTGTGTCATAG
CCATGATATCCCACTTGCGTGTTGACGTGTTATACAGCGCTGTCATTGCCGACGAGGACAAGAAGGCACTGGAAA
CACTGTCCAATTCAATCATCAAGGAGAAGCAGCCCTTTGAGCGCCTTGAGATGACCAAAAGCGAACTCCTCGAGA
TGTTCAGGTACAGCAAATACAAAGAATACTTTATCAACCAGCGTGTCCCCGAAGGGACCAAGAGCACCGTCTATC
GATGCGGACCTCTTATCGATTTGTGCCGGGGACCGCACGTTCCTCATACGGGCAATATCAAGGCCTTTTCCGTGT
TAAGGGTATGTCTTTGATCATCAGACATGCGTGCTCCACCATCTAACGAGACGCAGAATTCGGCTGCCTACTGGC
TTGGCGACAGCAAGAACGAGTCCGTTCAGCGTATTGCTGGCATCTCATTTCCCGACAAGAAGCAACTCGAGGAGT
ACAAGACGTTCTTGGCAGAGGCGGCCAAACGCAATCATCGCAAAATTGGCCAAGATCAAAAGTTGTTTTTCTGGG
ACGAAATGTCTCCAGGTTCAACCTTTTGGTTGCCCCATGGCACGAGAATCTATAACGCTCTCATGGATTTGATGA
AGAATGAGTATCACAAACGCGGCTTTGTGGAAGTCATGTCTCCCAACATGTACAAAGCAGACCTTTGGAAAGTGT
CGGGTCATTGGAATCACTATGAGGAGAACATGTTTACCTTTGACGTGGAGAAGGAGAAGTTTGGATTGAAACCCA
TGAATTGTCCCGGCCACTGCAAAATATTTGCGCACTCAGACGTTACCTATAGGGAGCTGCCGTGGCGAATGGCCG
ACTTTGGTGTCCTTCATCGCAACGAGTTCTCGGGTGCTCTTTCAGGACTTACTCGCGTGCGTAGGTTCCAACAGG
ATGACGCTCATATCTTCTGTACTGTCGATCAGGTTCGTTGATTCCAGCCGGGAAATTGGGACCATGGGCCTAGGA
TTTGAAAAAGCTAACACGTGGACCCCACTAGATTCGACAAGAAATTGAAGGCGCCTTCGACTTTCTATACGGGGT
CTATGGACTCTTTGGCTTCAAATTCAAGCTCAAGCTCTCGACTCGTCCCGAAAAGTATATTGGCGAAATTGCCAT
GTGGGACATGGCTGAGGCTAAACTCAAGGAAGCATTGGATTCGTTTACTGCAAAGATTGGCGCCCAGTGGGAGGA
AAACGCTGGCGATGGTGCTTTCTACGGTCCCAAGATTGACATCACTGTGTATGACGCCCTGAGGCGTGACCATCA
GTGCGGCACCATCCAGCTTGATTTTAATCTGCCTCAGCGGTTCAAGCTTCGATACGTGGCGGCCAAGGGTGACAG
TGGAGCTGCAACGACGGGTGACGATGCCGACCTGCCTATTGGGTACGCCCGCCCGGTAATGATACACCGCGCAGT
GCTAGGAAGCTTTGAAAGAATGATTGGCATTCTCACAGAACACTTTGGCGGCAAGTGGCCATTTTGGCTCAGTCC
TCGGCAGGTTCTTGTGGTACCGGTGATGCCGGGCGTCAATGACTATGCCCATGAGGTGCAAAAACTCTTACACGA
TCACGGACTGCATGCAGATGCGGATGTGAGCAGCAACACATTCCAGAAGAAGATTCGCACGGGACAGCTGGAACA
GTTCAATTTCATATTTGGTAAGCTGAGCCATGTCGTGTTGTTCTCATGTTGCTCTCAGAAACCAAGTACTGATTG
GCTTGACAGTTGTTGGAGCGGAGGAGGCCAAGTCACGAACAGTTAACATTCGGAATCGCGATGACCAGAGCACGC
AGAGCAAAGGCGAGCTGGTACCACTATCGGAAGCTCTAGAGCACCTCGTCAAACTCAAGGCAGCAAGGCGACTGG
AGAACAAGTTTCAAGGCGAGGAGACTGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail