Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2536
Gene name
LocationContig_1937:140..1604
Strand+
Gene length (bp)1464
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00645 zf-PARP Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region 3.4E-21 7 98

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7K9|YGI7_SCHPO PARP-type zinc finger-containing protein C2A9.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.07c PE=1 SV=3 4 107 7.0E-20
sp|O13706|YEU7_SCHPO PARP-type zinc finger-containing protein C13F5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.07c PE=3 SV=2 4 107 2.0E-12

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3901
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2536 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3120
Ophiocordyceps camponoti-floridani Ophcf2|00834
Ophiocordyceps camponoti-rufipedis Ophun1|5520
Ophiocordyceps kimflemingae Ophio5|7122
Ophiocordyceps subramaniannii Hirsu2|7774

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2536
MPQYRVEKSKNSRAGCKDNVCKSNQVKILKDELRFGTWVDIQGNGSWSWKHWGCVSGAQLVSVQEVCDKGDGEYD
FDIIEGYDELSESELQEKVARCVKQGHIDAQDFKGDPEKNVPGEKGIHLTATQKAKLATKESASDDASAPKKQLA
KRGRKKAAADEDEDGEPVAKKAKPAKTAKTSSKDANERPAPSRPSRAKAVAKKPVKDDESADSEAAATDEEEAAA
KPSRRAIGKAKEGVDRTNKAKAPAPKKRADKEADKPKEPDNKSRRASRAATKASVDDEDGMDEDGEEHEDNKAQP
AEPVVETKSKRGRKAKEPAAAPQAEASSEKGRPRRGRPRKA*
Coding >OphauG2|2536
ATGCCTCAGTATCGCGTTGAAAAATCGAAAAACAGCCGGGCTGGTTGCAAGGACAATGTCTGCAAGTCCAATCAG
GTCAAGATTCTCAAGGACGAACTTCGCTTTGGCACTTGGGTCGATATCCAAGGCAATGGCAGCTGGTCATGGAAG
CACTGGGGCTGTGTATCTGGTGCTCAGCTTGTCAGTGTCCAGGAAGTGTGCGACAAGGGTGACGGAGAGTACGAC
TTTGATATCATCGAAGGCTATGATGAGCTCAGCGAGTCTGAGCTTCAGGAAAAGGTGGCGCGCTGCGTCAAGCAG
GGCCACATTGATGCCCAAGACTTCAAGGGTGATCCCGAGAAGAATGTGCCAGGCGAAAAGGGCATCCACCTAACA
GCCACGCAAAAGGCCAAGCTGGCAACCAAAGAGTCTGCTTCCGACGACGCATCGGCTCCTAAGAAGCAGCTCGCC
AAGCGCGGACGCAAGAAGGCTGCTGCTGATGAGGACGAGGATGGGGAGCCCGTTGCCAAGAAAGCAAAGCCGGCC
AAGACGGCCAAGACAAGCTCCAAGGATGCCAACGAAAGGCCTGCTCCTTCCCGTCCTTCCCGTGCCAAGGCGGTG
GCAAAAAAGCCTGTCAAGGACGACGAGTCTGCAGATTCAGAGGCTGCAGCGACTGATGAGGAAGAAGCGGCTGCT
AAGCCATCGCGCCGGGCCATAGGCAAAGCCAAAGAGGGTGTCGACAGGACCAACAAGGCCAAGGCTCCCGCTCCC
AAGAAGCGAGCCGACAAGGAGGCTGACAAGCCCAAGGAGCCGGACAACAAGAGCCGCAGGGCGTCGCGTGCGGCT
ACTAAAGCCTCGGTTGATGACGAGGATGGCATGGACGAGGATGGCGAGGAGCACGAGGACAACAAGGCGCAGCCA
GCGGAGCCAGTTGTCGAGACCAAGAGCAAGCGCGGTCGCAAGGCCAAGGAGCCAGCTGCTGCGCCTCAGGCCGAG
GCGAGCTCCGAGAAGGGCCGACCTCGCCGCGGCAGACCTCGCAAGGCCTAA
Transcript >OphauG2|2536
ATGCCTCAGTATCGCGTTGAAAAATCGAAAAACAGCCGGGCTGGTTGCAAGGACAATGTCTGCAAGTCCAATCAG
GTCAAGATTCTCAAGGACGAACTTCGCTTTGGCACTTGGGTCGATATCCAAGGCAATGGCAGCTGGTCATGGAAG
CACTGGGGCTGTGTATCTGGTGCTCAGCTTGTCAGTGTCCAGGAAGTGTGCGACAAGGGTGACGGAGAGTACGAC
TTTGATATCATCGAAGGCTATGATGAGCTCAGCGAGTCTGAGCTTCAGGAAAAGGTGGCGCGCTGCGTCAAGCAG
GGCCACATTGATGCCCAAGACTTCAAGGGTGATCCCGAGAAGAATGTGCCAGGCGAAAAGGGCATCCACCTAACA
GCCACGCAAAAGGCCAAGCTGGCAACCAAAGAGTCTGCTTCCGACGACGCATCGGCTCCTAAGAAGCAGCTCGCC
AAGCGCGGACGCAAGAAGGCTGCTGCTGATGAGGACGAGGATGGGGAGCCCGTTGCCAAGAAAGCAAAGCCGGCC
AAGACGGCCAAGACAAGCTCCAAGGATGCCAACGAAAGGCCTGCTCCTTCCCGTCCTTCCCGTGCCAAGGCGGTG
GCAAAAAAGCCTGTCAAGGACGACGAGTCTGCAGATTCAGAGGCTGCAGCGACTGATGAGGAAGAAGCGGCTGCT
AAGCCATCGCGCCGGGCCATAGGCAAAGCCAAAGAGGGTGTCGACAGGACCAACAAGGCCAAGGCTCCCGCTCCC
AAGAAGCGAGCCGACAAGGAGGCTGACAAGCCCAAGGAGCCGGACAACAAGAGCCGCAGGGCGTCGCGTGCGGCT
ACTAAAGCCTCGGTTGATGACGAGGATGGCATGGACGAGGATGGCGAGGAGCACGAGGACAACAAGGCGCAGCCA
GCGGAGCCAGTTGTCGAGACCAAGAGCAAGCGCGGTCGCAAGGCCAAGGAGCCAGCTGCTGCGCCTCAGGCCGAG
GCGAGCTCCGAGAAGGGCCGACCTCGCCGCGGCAGACCTCGCAAGGCCTAA
Gene >OphauG2|2536
ATGCCTCAGTATCGCGTTGGTGAGTCGTGAACCCTGACGCTACCCTCTCACGTGGCGGCACACGCTCTTTGTGAG
CCTCTTGAAGCTGTCTGTGCCGCGCATAGCACGACGTGTCAATCAAAAAAAAAAAATATTGCTAATCCCCTCTGC
AGAAAAATCGAAAAACAGCCGGGCTGGTTGCAAGGACAATGTCTGCAAGTCCAATCAGGTCAAGATTCTCAAGGA
CGAACTTCGCTTTGGCACTTGGGTCGATATCCAAGGCAATGGCAGCTGGTCATGGAAGCACTGGTACAAAATGCC
CATTTTCTCTGCATCTTGTGCTTCGTCTGCTCAAGCATCCCATGCTGACACCACTCTAGGGGCTGTGTATCTGGT
GCTCAGCTTGTCAGTGTCCAGGAAGTGTGCGACAAGGGTGACGGAGAGTACGACTTTGATATCATCGAAGGCTAT
GATGAGCTCAGGTGATATCCTGCCCACTGTGTCTAATTTCTTGTCCCCTTTTTCTCATATTTTCTTAGCGAGTCT
GAGCTTCAGGAAAAGGTGGCGCGCTGCGTCAAGCAGGGCCACATTGATGCCCAAGACTTCAAGGGTGTGAGTGCT
TCATGCTGCCCTCTTTTTTCCCCCTGTGCTTGCCCACAAGGCACCCTTTTATAGACATTGTTTCATCATCTGACA
TGTACGCACCACTCTGACTGACAGCCGAGTTTTAGGATCCCGAGAAGAATGTGCCAGGCGAAAAGGGCATCCACC
TAACAGCCACGCAAAAGGCCAAGCTGGCAACCAAAGAGGTAACAAAAAAAATGTCTTGTTTGTTTTACATTATGC
GTCAGGCTCACATGCCTCCAGTCTGCTTCCGACGACGCATCGGCTCCTAAGAAGCAGCTCGCCAAGCGCGGACGC
AAGAAGGCTGCTGCTGATGAGGACGAGGATGGGGAGCCCGTTGCCAAGAAAGCAAAGCCGGCCAAGACGGCCAAG
ACAAGCTCCAAGGATGCCAACGAAAGGCCTGCTCCTTCCCGTCCTTCCCGTGCCAAGGCGGTGGCAAAAAAGCCT
GTCAAGGACGACGAGTCTGCAGATTCAGAGGCTGCAGCGACTGATGAGGAAGAAGCGGCTGCTAAGCCATCGCGC
CGGGCCATAGGCAAAGCCAAAGAGGGTGTCGACAGGACCAACAAGGCCAAGGCTCCCGCTCCCAAGAAGCGAGCC
GACAAGGAGGCTGACAAGCCCAAGGAGCCGGACAACAAGAGCCGCAGGGCGTCGCGTGCGGCTACTAAAGCCTCG
GTTGATGACGAGGATGGCATGGACGAGGATGGCGAGGAGCACGAGGACAACAAGGCGCAGCCAGCGGAGCCAGTT
GTCGAGACCAAGAGCAAGCGCGGTCGCAAGGCCAAGGAGCCAGCTGCTGCGCCTCAGGCCGAGGCGAGCTCCGAG
AAGGGCCGACCTCGCCGCGGCAGACCTCGCAAGGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail