Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2474
Gene name
LocationContig_19:50367..51397
Strand-
Gene length (bp)1030
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01875 Memo Memo-like protein 5.8E-68 6 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91VH6|MEMO1_MOUSE Protein MEMO1 OS=Mus musculus GN=Memo1 PE=1 SV=1 1 318 2.0E-61
sp|Q4QQR9|MEMO1_RAT Protein MEMO1 OS=Rattus norvegicus GN=Memo1 PE=1 SV=1 1 318 2.0E-61
sp|Q4R6D9|MEMO1_MACFA Protein MEMO1 OS=Macaca fascicularis GN=MEMO1 PE=2 SV=1 1 318 3.0E-61
sp|Q9Y316|MEMO1_HUMAN Protein MEMO1 OS=Homo sapiens GN=MEMO1 PE=1 SV=1 1 318 3.0E-61
sp|Q10212|YAY4_SCHPO MEMO1 family protein C4H3.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.04c PE=3 SV=1 2 321 4.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91VH6|MEMO1_MOUSE Protein MEMO1 OS=Mus musculus GN=Memo1 PE=1 SV=1 1 318 2.0E-61
sp|Q4QQR9|MEMO1_RAT Protein MEMO1 OS=Rattus norvegicus GN=Memo1 PE=1 SV=1 1 318 2.0E-61
sp|Q4R6D9|MEMO1_MACFA Protein MEMO1 OS=Macaca fascicularis GN=MEMO1 PE=2 SV=1 1 318 3.0E-61
sp|Q9Y316|MEMO1_HUMAN Protein MEMO1 OS=Homo sapiens GN=MEMO1 PE=1 SV=1 1 318 3.0E-61
sp|Q10212|YAY4_SCHPO MEMO1 family protein C4H3.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.04c PE=3 SV=1 2 321 4.0E-61
sp|Q6DJ03|MEMO1_XENTR Protein MEMO1 OS=Xenopus tropicalis GN=memo1 PE=2 SV=1 4 318 9.0E-61
sp|Q6GNT9|MEMO1_XENLA Protein MEMO1 OS=Xenopus laevis GN=memo1 PE=2 SV=1 4 318 2.0E-60
sp|Q803S3|MEMO1_DANRE Protein MEMO1 OS=Danio rerio GN=memo1 PE=2 SV=1 1 318 2.0E-60
sp|P47085|YJX8_YEAST MEMO1 family protein YJR008W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR008W PE=1 SV=1 1 321 3.0E-60
sp|Q2HJH7|MEMO1_BOVIN Protein MEMO1 OS=Bos taurus GN=MEMO1 PE=2 SV=1 4 302 9.0E-59
sp|Q54NZ1|MEMO1_DICDI Protein MEMO1 homolog OS=Dictyostelium discoideum GN=memo1 PE=3 SV=1 4 316 1.0E-58
sp|Q22915|TG253_CAEEL MEMO1 family protein tag-253 OS=Caenorhabditis elegans GN=tag-253 PE=3 SV=3 3 304 7.0E-55
sp|A9A2Y3|Y215_NITMS MEMO1 family protein Nmar_0215 OS=Nitrosopumilus maritimus (strain SCM1) GN=Nmar_0215 PE=3 SV=1 1 203 7.0E-20
sp|Q46CL1|Y1422_METBF MEMO1 family protein Mbar_A1422 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A1422 PE=3 SV=1 4 318 3.0E-19
sp|Q8TWR9|Y963_METKA MEMO1 family protein MK0963 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0963 PE=3 SV=1 1 227 3.0E-17
sp|Q96YW6|Y2062_SULTO MEMO1 family protein STK_20620 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_20620 PE=3 SV=1 1 203 1.0E-16
sp|Q8U0F2|Y1638_PYRFU MEMO1 family protein PF1638 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1638 PE=3 SV=1 49 214 8.0E-16
sp|O67039|Y890_AQUAE MEMO1 family protein aq_890 OS=Aquifex aeolicus (strain VF5) GN=aq_890 PE=3 SV=1 1 200 2.0E-15
sp|Q8PW40|Y1761_METMA MEMO1 family protein MM_1761 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1761 PE=3 SV=1 1 318 3.0E-15
sp|Q4JCG3|Y089_SULAC MEMO1 family protein Saci_0089 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0089 PE=3 SV=1 1 203 6.0E-15
sp|O26151|Y045_METTH MEMO1 family protein MTH_45 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_45 PE=3 SV=1 1 285 7.0E-15
sp|C5A7L6|Y1726_THEGJ MEMO1 family protein TGAM_1726 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=TGAM_1726 PE=3 SV=1 49 313 8.0E-15
sp|Q5JJC3|Y1477_THEKO MEMO1 family protein TK1477 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1477 PE=3 SV=1 49 277 1.0E-14
sp|O59292|Y1626_PYRHO MEMO1 family protein PH1626 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1626 PE=3 SV=2 49 322 4.0E-14
sp|P95994|Y066_SULSO MEMO1 family protein SSO0066 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0066 PE=3 SV=1 49 319 1.0E-13
sp|C3MJQ3|Y2219_SULIL MEMO1 family protein LS215_2219 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=LS215_2219 PE=3 SV=1 49 319 2.0E-13
sp|Q9HLJ1|Y237_THEAC MEMO1 family protein Ta0237 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0237 PE=3 SV=1 1 200 2.0E-13
sp|A4YIM6|Y2139_METS5 MEMO1 family protein Msed_2139 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2139 PE=3 SV=1 1 203 2.0E-13
sp|A8M9U2|Y1590_CALMQ MEMO1 family protein Cmaq_1590 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=Cmaq_1590 PE=3 SV=1 1 203 2.0E-13
sp|A5UN65|Y1438_METS3 MEMO1 family protein Msm_1438 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=Msm_1438 PE=3 SV=1 1 277 5.0E-13
sp|C3MZ11|Y2054_SULIM MEMO1 family protein M1425_2054 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=M1425_2054 PE=3 SV=1 48 319 5.0E-13
sp|C3N060|Y2134_SULIA MEMO1 family protein M1627_2134 OS=Sulfolobus islandicus (strain M.16.27) GN=M1627_2134 PE=3 SV=1 48 319 5.0E-13
sp|C4KJ99|Y2061_SULIK MEMO1 family protein M164_2061 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=M164_2061 PE=3 SV=1 48 319 5.0E-13
sp|Q9V189|Y539_PYRAB MEMO1 family protein PYRAB05390 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB05390 PE=3 SV=1 49 318 7.0E-13
sp|A1RTJ4|Y1105_PYRIL MEMO1 family protein Pisl_1105 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=Pisl_1105 PE=3 SV=1 1 284 7.0E-13
sp|B6YST0|Y132_THEON MEMO1 family protein TON_0132 OS=Thermococcus onnurineus (strain NA1) GN=TON_0132 PE=3 SV=1 1 214 8.0E-13
sp|C3N8S4|Y2180_SULIY MEMO1 family protein YG5714_2180 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=YG5714_2180 PE=3 SV=1 49 319 1.0E-12
sp|Q8ZYE1|Y818_PYRAE MEMO1 family protein PAE0818 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE0818 PE=3 SV=1 1 284 1.0E-12
sp|C3NMP4|Y739_SULIN MEMO1 family protein YN1551_0739 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=YN1551_0739 PE=3 SV=1 49 319 2.0E-12
sp|Q8TT38|Y601_METAC MEMO1 family protein MA_0601 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_0601 PE=3 SV=1 1 285 3.0E-12
sp|Q978N2|Y1383_THEVO MEMO1 family protein TV1383 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1383 PE=3 SV=1 1 200 4.0E-12
sp|Q12TI1|Y2394_METBU MEMO1 family protein Mbur_2394 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=Mbur_2394 PE=3 SV=1 4 200 8.0E-12
sp|A3MS51|Y028_PYRCJ MEMO1 family protein Pcal_0028 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=Pcal_0028 PE=3 SV=1 1 203 2.0E-11
sp|P61652|Y1387_METMP MEMO1 family protein MMP1387 OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1387 PE=3 SV=1 48 200 2.0E-11
sp|A6VGX3|Y632_METM7 MEMO1 family protein MmarC7_0632 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0632 PE=3 SV=1 48 200 2.0E-11
sp|A9A9S6|Y1286_METM6 MEMO1 family protein MmarC6_1286 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=MmarC6_1286 PE=3 SV=1 48 200 4.0E-11
sp|A4WH12|Y062_PYRAR MEMO1 family protein Pars_0062 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=Pars_0062 PE=3 SV=1 1 203 5.0E-11
sp|A4FWD2|Y191_METM5 MEMO1 family protein MmarC5_0191 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0191 PE=3 SV=1 48 289 5.0E-11
sp|A8AB69|Y992_IGNH4 MEMO1 family protein Igni_0992 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=Igni_0992 PE=3 SV=1 1 203 6.0E-11
sp|Q57846|Y403_METJA MEMO1 family protein MJ0403 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0403 PE=3 SV=1 9 319 2.0E-10
sp|O67355|Y1336_AQUAE MEMO1 family protein aq_1336 OS=Aquifex aeolicus (strain VF5) GN=aq_1336 PE=3 SV=1 4 204 8.0E-10
sp|A6UQ31|Y697_METVS MEMO1 family protein Mevan_0697 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0697 PE=3 SV=1 48 288 8.0E-10
sp|B8D6F2|Y1357_DESK1 MEMO1 family protein DKAM_1357 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=DKAM_1357 PE=3 SV=1 1 203 2.0E-09
sp|A5IKY3|Y837_THEP1 MEMO1 family protein Tpet_0837 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0837 PE=3 SV=1 1 200 5.0E-09
sp|B1LA64|Y860_THESQ MEMO1 family protein TRQ2_0860 OS=Thermotoga sp. (strain RQ2) GN=TRQ2_0860 PE=3 SV=1 1 218 5.0E-09
sp|B9K748|Y605_THENN MEMO1 family protein CTN_0605 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=CTN_0605 PE=3 SV=1 4 143 4.0E-08
sp|Q9WXU2|Y087_THEMA MEMO1 family protein TM_0087 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0087 PE=3 SV=1 1 200 8.0E-08
sp|Q9YB24|Y1771_AERPE MEMO1 family protein APE_1771 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_1771 PE=3 SV=1 1 200 2.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5631
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2474 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4476
Ophiocordyceps camponoti-floridani Ophcf2|03329
Ophiocordyceps camponoti-rufipedis Ophun1|5872
Ophiocordyceps kimflemingae Ophio5|5052
Ophiocordyceps subramaniannii Hirsu2|7733

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2474
MATRPATKAGAWYTGSPDALAKELDGFLAAVPDTIDASSLPIPGARVIIAPHAGYRYSGKCAAWAYRCLDLTDVK
RVFLLGPSHTYYLDDCAVTTYAKYQTPFGDFKVDADTLQQIKHAGHMKDIPRGKDADEHSLEMHLPYLWKRCQQT
FDSPDQFPPVVPILVGDLDVQEEKAVGNILLPFLRDKANAFIVSSDFCHWGQHFRYMVYAAKGDISRLTKLRAND
GAPTGPPIHETIRLLDETAMEAVGSGKHDALAENLRVTNNTVCGRHPIGVMMAGLELLAAEGSGESKCRFHVVQY
DRSNLVQTPGDYSVSYVSAYAKTM*
Coding >OphauG2|2474
ATGGCCACTCGGCCCGCCACCAAGGCCGGTGCATGGTATACGGGCAGCCCCGATGCTCTTGCAAAGGAGCTCGAT
GGATTCCTTGCTGCAGTACCAGACACTATTGACGCCTCGTCACTGCCCATACCTGGCGCCAGAGTTATTATTGCC
CCACATGCCGGCTATCGCTACTCGGGAAAATGTGCTGCTTGGGCCTACCGCTGCCTTGACCTGACGGACGTGAAG
CGCGTCTTCCTCCTTGGCCCCTCGCACACGTACTACCTTGATGACTGTGCCGTGACAACCTACGCCAAGTATCAA
ACACCATTTGGCGATTTCAAAGTGGATGCCGACACGCTGCAACAAATCAAGCACGCAGGCCACATGAAGGATATC
CCGCGCGGCAAGGACGCCGACGAGCACTCTCTCGAGATGCATCTGCCCTATCTGTGGAAGCGTTGCCAGCAGACG
TTTGACTCGCCCGACCAGTTCCCGCCAGTGGTGCCGATACTGGTTGGCGACCTGGACGTGCAAGAGGAAAAGGCT
GTTGGCAACATTCTACTCCCATTTCTCAGGGACAAGGCAAATGCCTTTATTGTGAGCTCTGATTTTTGCCATTGG
GGACAGCACTTCCGGTACATGGTCTACGCAGCCAAAGGCGACATTTCCAGGCTGACCAAGCTGCGTGCCAACGAC
GGGGCGCCGACGGGCCCGCCCATACATGAGACAATTCGGCTTCTCGACGAGACGGCCATGGAGGCGGTGGGCAGC
GGTAAACACGACGCGCTGGCGGAAAATCTCAGAGTGACCAACAACACGGTATGTGGCAGGCATCCTATTGGTGTC
ATGATGGCTGGCCTTGAACTGCTGGCGGCCGAGGGGAGCGGCGAGTCCAAGTGCCGATTTCACGTGGTGCAATAT
GATCGCAGCAATCTGGTGCAGACGCCAGGAGACTATAGTGTCAGTTACGTATCTGCATATGCCAAGACGATGTGA
Transcript >OphauG2|2474
ATGGCCACTCGGCCCGCCACCAAGGCCGGTGCATGGTATACGGGCAGCCCCGATGCTCTTGCAAAGGAGCTCGAT
GGATTCCTTGCTGCAGTACCAGACACTATTGACGCCTCGTCACTGCCCATACCTGGCGCCAGAGTTATTATTGCC
CCACATGCCGGCTATCGCTACTCGGGAAAATGTGCTGCTTGGGCCTACCGCTGCCTTGACCTGACGGACGTGAAG
CGCGTCTTCCTCCTTGGCCCCTCGCACACGTACTACCTTGATGACTGTGCCGTGACAACCTACGCCAAGTATCAA
ACACCATTTGGCGATTTCAAAGTGGATGCCGACACGCTGCAACAAATCAAGCACGCAGGCCACATGAAGGATATC
CCGCGCGGCAAGGACGCCGACGAGCACTCTCTCGAGATGCATCTGCCCTATCTGTGGAAGCGTTGCCAGCAGACG
TTTGACTCGCCCGACCAGTTCCCGCCAGTGGTGCCGATACTGGTTGGCGACCTGGACGTGCAAGAGGAAAAGGCT
GTTGGCAACATTCTACTCCCATTTCTCAGGGACAAGGCAAATGCCTTTATTGTGAGCTCTGATTTTTGCCATTGG
GGACAGCACTTCCGGTACATGGTCTACGCAGCCAAAGGCGACATTTCCAGGCTGACCAAGCTGCGTGCCAACGAC
GGGGCGCCGACGGGCCCGCCCATACATGAGACAATTCGGCTTCTCGACGAGACGGCCATGGAGGCGGTGGGCAGC
GGTAAACACGACGCGCTGGCGGAAAATCTCAGAGTGACCAACAACACGGTATGTGGCAGGCATCCTATTGGTGTC
ATGATGGCTGGCCTTGAACTGCTGGCGGCCGAGGGGAGCGGCGAGTCCAAGTGCCGATTTCACGTGGTGCAATAT
GATCGCAGCAATCTGGTGCAGACGCCAGGAGACTATAGTGTCAGTTACGTATCTGCATATGCCAAGACGATGTGA
Gene >OphauG2|2474
ATGGCCACTCGGCCCGCCACCAAGGCCGGTGCATGGTATACGGGCAGCCCCGATGCTCTTGCAAAGGAGCTCGAT
GGATTCCTTGCTGCAGTACCAGACACTATTGACGCCTCGTCACTGCCCATACCTGGCGCCAGAGTTATTATTGCC
CCGTGGGTGCAACTTGTCCCCCTTTGCCCCATGACTATGCTGCTGACAGGACGACAGACATGCCGGCTATCGCTA
CTCGGGAAAATGTGCTGCTTGGGCCTACCGCTGCCTTGACCTGACGGACGTGAAGCGCGTCTTCCTCCTTGGCCC
CTCGCACACGTACTACCTTGATGACTGTGCCGTGACAACCTACGCCAAGTATCAAACACCATTTGGCGATTTCAA
AGTGGATGCCGACACGCTGCAACAAATCAAGCACGCAGGCCACATGAAGGATATCCCGCGCGGCAAGGACGCCGA
CGAGCACTCTCTCGAGATGCATCTGCCCTATCTGTGGAAGCGTTGCCAGCAGACGTTTGACTCGCCCGACCAGTT
CCCGCCAGTGGTGCCGATACTGGTTGGCGACCTGGACGTGCAAGAGGAAAAGGCTGTTGGCAACATTCTACTCCC
ATTTCTCAGGGACAAGGCAAATGCCTTTATTGTGAGCTCTGATTTTTGCCATTGGGGACAGCACTTCCGGTACAT
GGTCTACGCAGCCAAAGGCGACATTTCCAGGCTGACCAAGCTGCGTGCCAACGACGGGGCGCCGACGGGCCCGCC
CATACATGAGACAATTCGGCTTCTCGACGAGACGGCCATGGAGGCGGTGGGCAGCGGTAAACACGACGCGCTGGC
GGAAAATCTCAGAGTGACCAACAACACGGTATGTGGCAGGCATCCTATTGGTGTCATGATGGCTGGCCTTGAACT
GCTGGCGGCCGAGGGGAGCGGCGAGTCCAAGTGCCGATTTCACGTGGTGCAATATGATCGCAGCAATCTGGTGCA
GACGCCAGGAGACTATAGTGTCAGTTACGTATCTGCATATGCCAAGACGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail