Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2460
Gene name
LocationContig_19:11387..12470
Strand-
Gene length (bp)1083
Transcript length (bp)1014
Coding sequence length (bp)1014
Protein length (aa) 338

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08213 COX24_C Mitochondrial mRNA-processing protein COX24, C-terminal 2.3E-09 305 336

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4608
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2460 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4463
Ophiocordyceps camponoti-floridani Ophcf2|03344
Ophiocordyceps camponoti-rufipedis Ophun1|6807
Ophiocordyceps kimflemingae Ophio5|62
Ophiocordyceps subramaniannii Hirsu2|9666

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2460
MLPSSLHRVAVAAAPQAGFAPLSVPRPAVALVALGHQRRFSSSKPSRSDKNDLSAGQSVPASSSSTRGSEKRKRK
PKDASDKASLFNKLPSVPSTSHMSQEALGLSSFFSLHRPISVTQTMPRKVSDEHFASIFTPRSKASKMMDTVSTI
SNSINQLDGPMSQMTISDHPDDPQMADSMQKVSLRNSDGSESSIYLQVDAMSGHFLPFCPPPLPDAQAHSSEGDA
AAETTTEASDAMEERPMVRSYKAMFSIEETLEPDGRMRILAHSPVIVSEQHPRSFLSRMALRRIRFDEARGRGRP
SMYALSTKRQRKLKIKKKKYKKLLKRTRNLRRKLDKN*
Coding >OphauG2|2460
ATGCTGCCTTCATCGCTTCACCGCGTCGCGGTTGCGGCAGCTCCGCAGGCCGGCTTTGCGCCCCTGTCGGTTCCT
CGCCCTGCCGTCGCACTCGTCGCACTCGGCCACCAGCGGAGATTCTCCTCGTCGAAGCCGTCGCGCTCCGACAAG
AATGATCTATCGGCCGGACAGTCGGTTCCAGCCTCGTCGTCTTCGACCCGCGGCAGCGAAAAGCGCAAGCGAAAG
CCAAAGGATGCCTCGGACAAGGCGTCCTTGTTCAACAAGTTGCCCAGCGTCCCCAGCACGAGCCACATGTCACAA
GAAGCCCTTGGTCTCTCGAGCTTCTTTTCGCTTCATCGCCCCATCTCGGTGACGCAGACGATGCCGCGGAAAGTG
TCGGACGAACACTTTGCATCCATATTTACGCCGCGCTCAAAGGCGAGCAAAATGATGGACACGGTGTCCACCATT
TCAAATTCCATCAACCAGCTCGACGGCCCCATGTCACAAATGACTATTTCCGATCACCCAGACGACCCGCAAATG
GCCGACTCGATGCAAAAAGTATCGCTGAGAAACTCGGACGGCAGCGAGTCGAGCATCTATCTTCAGGTCGATGCC
ATGTCGGGCCACTTTTTGCCCTTTTGTCCCCCACCGCTGCCCGACGCCCAAGCCCACTCGAGCGAGGGCGACGCT
GCGGCCGAGACGACGACCGAGGCAAGCGACGCCATGGAGGAGCGACCCATGGTGCGAAGCTACAAGGCCATGTTT
TCCATTGAAGAGACGCTGGAGCCCGACGGCCGTATGCGCATCCTCGCCCACAGTCCTGTCATTGTCAGCGAGCAG
CATCCGCGCAGCTTCTTGTCGCGCATGGCGCTTCGCCGGATTCGGTTTGACGAGGCACGTGGGCGTGGGCGCCCA
AGCATGTACGCCCTCAGCACCAAGCGGCAACGGAAGCTCAAGATTAAGAAGAAGAAGTACAAAAAGCTGTTGAAG
CGGACGCGCAATTTGCGTCGCAAGCTGGACAAGAATTAA
Transcript >OphauG2|2460
ATGCTGCCTTCATCGCTTCACCGCGTCGCGGTTGCGGCAGCTCCGCAGGCCGGCTTTGCGCCCCTGTCGGTTCCT
CGCCCTGCCGTCGCACTCGTCGCACTCGGCCACCAGCGGAGATTCTCCTCGTCGAAGCCGTCGCGCTCCGACAAG
AATGATCTATCGGCCGGACAGTCGGTTCCAGCCTCGTCGTCTTCGACCCGCGGCAGCGAAAAGCGCAAGCGAAAG
CCAAAGGATGCCTCGGACAAGGCGTCCTTGTTCAACAAGTTGCCCAGCGTCCCCAGCACGAGCCACATGTCACAA
GAAGCCCTTGGTCTCTCGAGCTTCTTTTCGCTTCATCGCCCCATCTCGGTGACGCAGACGATGCCGCGGAAAGTG
TCGGACGAACACTTTGCATCCATATTTACGCCGCGCTCAAAGGCGAGCAAAATGATGGACACGGTGTCCACCATT
TCAAATTCCATCAACCAGCTCGACGGCCCCATGTCACAAATGACTATTTCCGATCACCCAGACGACCCGCAAATG
GCCGACTCGATGCAAAAAGTATCGCTGAGAAACTCGGACGGCAGCGAGTCGAGCATCTATCTTCAGGTCGATGCC
ATGTCGGGCCACTTTTTGCCCTTTTGTCCCCCACCGCTGCCCGACGCCCAAGCCCACTCGAGCGAGGGCGACGCT
GCGGCCGAGACGACGACCGAGGCAAGCGACGCCATGGAGGAGCGACCCATGGTGCGAAGCTACAAGGCCATGTTT
TCCATTGAAGAGACGCTGGAGCCCGACGGCCGTATGCGCATCCTCGCCCACAGTCCTGTCATTGTCAGCGAGCAG
CATCCGCGCAGCTTCTTGTCGCGCATGGCGCTTCGCCGGATTCGGTTTGACGAGGCACGTGGGCGTGGGCGCCCA
AGCATGTACGCCCTCAGCACCAAGCGGCAACGGAAGCTCAAGATTAAGAAGAAGAAGTACAAAAAGCTGTTGAAG
CGGACGCGCAATTTGCGTCGCAAGCTGGACAAGAATTAA
Gene >OphauG2|2460
ATGCTGCCTTCATCGCTTCACCGCGTCGCGGTTGCGGCAGCTCCGCAGGCCGGCTTTGCGCCCCTGTCGGTTCCT
CGCCCTGCCGTCGCACTCGTCGCACTCGGCCACCAGCGGAGATTCTCCTCGTCGAAGCCGTCGCGCTCCGACAAG
AATGATCTATCGGCCGGACAGTCGGTTCCAGCCTCGTCGTCTTCGACCCGCGGCAGCGAAAAGCGCAAGCGAAAG
CCAAAGGATGCCTCGGACAAGGCGTCCTTGTTCAACAAGTTGCCCAGCGTCCCCAGCACGAGCCACATGTCACAA
GAAGGTTATTGCCGCCCTCGGACCCCTTCTCGGACTCGGTACTGACCCTTTTTTTCTCCTTTGTTCTTGCTAGCC
CTTGGTCTCTCGAGCTTCTTTTCGCTTCATCGCCCCATCTCGGTGACGCAGACGATGCCGCGGAAAGTGTCGGAC
GAACACTTTGCATCCATATTTACGCCGCGCTCAAAGGCGAGCAAAATGATGGACACGGTGTCCACCATTTCAAAT
TCCATCAACCAGCTCGACGGCCCCATGTCACAAATGACTATTTCCGATCACCCAGACGACCCGCAAATGGCCGAC
TCGATGCAAAAAGTATCGCTGAGAAACTCGGACGGCAGCGAGTCGAGCATCTATCTTCAGGTCGATGCCATGTCG
GGCCACTTTTTGCCCTTTTGTCCCCCACCGCTGCCCGACGCCCAAGCCCACTCGAGCGAGGGCGACGCTGCGGCC
GAGACGACGACCGAGGCAAGCGACGCCATGGAGGAGCGACCCATGGTGCGAAGCTACAAGGCCATGTTTTCCATT
GAAGAGACGCTGGAGCCCGACGGCCGTATGCGCATCCTCGCCCACAGTCCTGTCATTGTCAGCGAGCAGCATCCG
CGCAGCTTCTTGTCGCGCATGGCGCTTCGCCGGATTCGGTTTGACGAGGCACGTGGGCGTGGGCGCCCAAGCATG
TACGCCCTCAGCACCAAGCGGCAACGGAAGCTCAAGATTAAGAAGAAGAAGTACAAAAAGCTGTTGAAGCGGACG
CGCAATTTGCGTCGCAAGCTGGACAAGAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail