Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2459
Gene name
LocationContig_19:7995..8777
Strand+
Gene length (bp)782
Transcript length (bp)723
Coding sequence length (bp)723
Protein length (aa) 241

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 1.9E-03 94 134
PF01476 LysM LysM domain 8.0E-03 189 218

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 71 232 1.0E-34
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 76 239 9.0E-30
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 62 233 3.0E-29
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 81 239 7.0E-19
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 99 237 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 71 232 1.0E-34
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 76 239 9.0E-30
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 62 233 3.0E-29
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 81 239 7.0E-19
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 99 237 1.0E-15
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 19 233 2.0E-15
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 88 141 7.0E-07
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 182 233 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2459
MKLLSPLVLLASVCQAADLAARYFAMGNQLVTRNSPPKLVEPQAGSHPPLARAVSSLASTATSLLPSTTPKPANE
VPTPTPVQPGTIAGCKAFYKVQKNDHCIEVARINNITLQDFLKWNPEVDGGACTNLWFGYYVCVSVTESPPPATT
LTTSTTSTTSTTTTTTTAITTPTPTQDGMVRNCKTFHWVEPSQTCETIAALYGVTSADIISWNPAAGPECKELWA
HTYCCVGVASKPVPA*
Coding >OphauG2|2459
ATGAAGCTGCTTTCTCCTCTTGTCCTCTTGGCCTCTGTCTGCCAGGCAGCAGATCTTGCAGCGCGGTATTTTGCC
ATGGGAAACCAGCTCGTGACCCGAAACTCGCCGCCCAAGTTGGTCGAGCCCCAGGCCGGCTCGCATCCTCCATTG
GCCAGAGCTGTGTCGTCTTTGGCTTCGACGGCGACTAGCTTGCTGCCGTCCACCACGCCCAAGCCGGCCAATGAG
GTTCCCACTCCAACTCCCGTGCAGCCGGGCACCATTGCCGGCTGCAAGGCCTTTTACAAGGTGCAAAAAAACGAC
CATTGCATCGAGGTGGCGAGAATAAACAACATTACGCTGCAAGACTTTCTCAAGTGGAATCCCGAGGTTGACGGC
GGGGCTTGCACCAATCTCTGGTTCGGCTACTACGTCTGTGTCTCGGTGACGGAGAGCCCGCCGCCTGCAACAACG
CTCACCACTTCCACCACTTCCACCACTTCCACAACCACCACAACCACCACAGCCATCACCACTCCCACGCCGACC
CAAGACGGCATGGTGCGCAACTGCAAGACCTTTCACTGGGTCGAGCCGAGCCAAACCTGCGAGACCATTGCGGCG
CTGTATGGCGTCACAAGCGCAGACATTATTTCCTGGAATCCGGCCGCTGGCCCCGAGTGTAAGGAGCTTTGGGCC
CATACCTATTGCTGCGTCGGTGTGGCTTCGAAGCCGGTGCCGGCTTGA
Transcript >OphauG2|2459
ATGAAGCTGCTTTCTCCTCTTGTCCTCTTGGCCTCTGTCTGCCAGGCAGCAGATCTTGCAGCGCGGTATTTTGCC
ATGGGAAACCAGCTCGTGACCCGAAACTCGCCGCCCAAGTTGGTCGAGCCCCAGGCCGGCTCGCATCCTCCATTG
GCCAGAGCTGTGTCGTCTTTGGCTTCGACGGCGACTAGCTTGCTGCCGTCCACCACGCCCAAGCCGGCCAATGAG
GTTCCCACTCCAACTCCCGTGCAGCCGGGCACCATTGCCGGCTGCAAGGCCTTTTACAAGGTGCAAAAAAACGAC
CATTGCATCGAGGTGGCGAGAATAAACAACATTACGCTGCAAGACTTTCTCAAGTGGAATCCCGAGGTTGACGGC
GGGGCTTGCACCAATCTCTGGTTCGGCTACTACGTCTGTGTCTCGGTGACGGAGAGCCCGCCGCCTGCAACAACG
CTCACCACTTCCACCACTTCCACCACTTCCACAACCACCACAACCACCACAGCCATCACCACTCCCACGCCGACC
CAAGACGGCATGGTGCGCAACTGCAAGACCTTTCACTGGGTCGAGCCGAGCCAAACCTGCGAGACCATTGCGGCG
CTGTATGGCGTCACAAGCGCAGACATTATTTCCTGGAATCCGGCCGCTGGCCCCGAGTGTAAGGAGCTTTGGGCC
CATACCTATTGCTGCGTCGGTGTGGCTTCGAAGCCGGTGCCGGCTTGA
Gene >OphauG2|2459
ATGAAGCTGCTTTCTCCTCTTGTCCTCTTGGCCTCTGTCTGCCAGGCAGCAGATCTTGCAGCGCGGTATTTTGCC
ATGGGAAACCAGCTCGTGACCCGAAACTCGCCGCCCAAGTTGGTCGAGCCCCAGGCCGGCTCGCATCCTCCATTG
GCCAGAGCTGTGTCGTCTTTGGCTTCGACGGCGACTAGCTTGCTGCCGTCCACCACGCCCAAGCCGGCCAATGAG
TGAGCCCGTCCTCCCGCCCCTTGTCCAACTGCGGCGCAGCTGACAAAATCCATGACAGGGTTCCCACTCCAACTC
CCGTGCAGCCGGGCACCATTGCCGGCTGCAAGGCCTTTTACAAGGTGCAAAAAAACGACCATTGCATCGAGGTGG
CGAGAATAAACAACATTACGCTGCAAGACTTTCTCAAGTGGAATCCCGAGGTTGACGGCGGGGCTTGCACCAATC
TCTGGTTCGGCTACTACGTCTGTGTCTCGGTGACGGAGAGCCCGCCGCCTGCAACAACGCTCACCACTTCCACCA
CTTCCACCACTTCCACAACCACCACAACCACCACAGCCATCACCACTCCCACGCCGACCCAAGACGGCATGGTGC
GCAACTGCAAGACCTTTCACTGGGTCGAGCCGAGCCAAACCTGCGAGACCATTGCGGCGCTGTATGGCGTCACAA
GCGCAGACATTATTTCCTGGAATCCGGCCGCTGGCCCCGAGTGTAAGGAGCTTTGGGCCCATACCTATTGCTGCG
TCGGTGTGGCTTCGAAGCCGGTGCCGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail