Protein ID | OphauG2|2456 |
Gene name | |
Location | Contig_19:1023..2037 |
Strand | + |
Gene length (bp) | 1014 |
Transcript length (bp) | 1014 |
Coding sequence length (bp) | 1014 |
Protein length (aa) | 338 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00701 | DHDPS | Dihydrodipicolinate synthetase family | 3.2E-41 | 26 | 304 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q5BD77|HOGA1_EMENI | Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1503 PE=1 SV=1 | 21 | 324 | 8.0E-121 |
sp|A8DRH7|LGA1_ASPNG | L-threo-3-deoxy-hexylosonate aldolase OS=Aspergillus niger GN=gaaC PE=3 SV=1 | 19 | 324 | 3.0E-88 |
sp|A6Y9S5|LGA1_HYPJE | L-threo-3-deoxy-hexylosonate aldolase OS=Hypocrea jecorina GN=lga1 PE=1 SV=1 | 19 | 324 | 3.0E-78 |
sp|P0CL20|HOGA1_COCIM | Putative 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Coccidioides immitis (strain RS) GN=CIMG_00151 PE=3 SV=1 | 25 | 263 | 1.0E-54 |
sp|Q6NY77|HOGA1_DANRE | 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Danio rerio GN=zgc:77082 PE=2 SV=1 | 21 | 315 | 1.0E-39 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q5BD77|HOGA1_EMENI | Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1503 PE=1 SV=1 | 21 | 324 | 8.0E-121 |
sp|A8DRH7|LGA1_ASPNG | L-threo-3-deoxy-hexylosonate aldolase OS=Aspergillus niger GN=gaaC PE=3 SV=1 | 19 | 324 | 3.0E-88 |
sp|A6Y9S5|LGA1_HYPJE | L-threo-3-deoxy-hexylosonate aldolase OS=Hypocrea jecorina GN=lga1 PE=1 SV=1 | 19 | 324 | 3.0E-78 |
sp|P0CL20|HOGA1_COCIM | Putative 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Coccidioides immitis (strain RS) GN=CIMG_00151 PE=3 SV=1 | 25 | 263 | 1.0E-54 |
sp|Q6NY77|HOGA1_DANRE | 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Danio rerio GN=zgc:77082 PE=2 SV=1 | 21 | 315 | 1.0E-39 |
sp|Q5M8W9|HOGA1_XENTR | 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Xenopus tropicalis GN=hoga1 PE=2 SV=2 | 26 | 298 | 7.0E-39 |
sp|Q5XGL6|HOGA1_XENLA | 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Xenopus laevis GN=hoga1 PE=2 SV=1 | 26 | 298 | 3.0E-38 |
sp|Q0P5I5|HOGA1_BOVIN | 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Bos taurus GN=HOGA1 PE=1 SV=1 | 26 | 302 | 1.0E-34 |
sp|Q86XE5|HOGA1_HUMAN | 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Homo sapiens GN=HOGA1 PE=1 SV=1 | 26 | 302 | 3.0E-34 |
sp|Q9DCU9|HOGA1_MOUSE | 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Mus musculus GN=Hoga1 PE=1 SV=1 | 26 | 302 | 5.0E-34 |
sp|Q5V5D4|DAPA_HALMA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=dapA PE=3 SV=1 | 26 | 244 | 1.0E-30 |
sp|Q12ZG2|DAPA_METBU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=dapA PE=3 SV=1 | 26 | 267 | 2.0E-29 |
sp|Q46DC4|DAPA_METBF | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=dapA PE=3 SV=1 | 35 | 267 | 2.0E-29 |
sp|A0B7E1|DAPA_METTP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=dapA PE=3 SV=1 | 26 | 263 | 1.0E-28 |
sp|B2A3B2|DAPA_NATTJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=dapA PE=3 SV=1 | 35 | 313 | 3.0E-27 |
sp|Q8PXL7|DAPA_METMA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dapA PE=3 SV=1 | 35 | 267 | 3.0E-27 |
sp|Q9I4W3|DAPA_PSEAE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dapA PE=1 SV=1 | 32 | 247 | 5.0E-27 |
sp|Q67P59|DAPA_SYMTH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dapA PE=3 SV=1 | 35 | 310 | 1.0E-26 |
sp|Q2FNR0|DAPA_METHJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=dapA PE=3 SV=1 | 41 | 255 | 2.0E-26 |
sp|A3CVI7|DAPA_METMJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=dapA PE=3 SV=1 | 40 | 263 | 2.0E-26 |
sp|Q3ISQ0|DAPA_NATPD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=dapA PE=3 SV=1 | 26 | 241 | 3.0E-26 |
sp|Q9HS19|DAPAL_HALSA | Uncharacterized DapA-like lyase VNG_0444G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dapAL PE=3 SV=2 | 26 | 320 | 5.0E-26 |
sp|B0R3D6|DAPAL_HALS3 | Uncharacterized DapA-like lyase OE_1665R OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=dapAL PE=3 SV=1 | 26 | 320 | 5.0E-26 |
sp|Q5JGK8|DAPAL_THEKO | Uncharacterized DapA-like lyase TK1237 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=dapAL PE=3 SV=1 | 26 | 268 | 6.0E-26 |
sp|B8GKG7|DAPA_METPE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=dapA PE=3 SV=1 | 53 | 263 | 7.0E-26 |
sp|Q8F132|DAPA_LEPIN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dapA PE=3 SV=1 | 26 | 300 | 7.0E-26 |
sp|Q72U22|DAPA_LEPIC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dapA PE=3 SV=1 | 26 | 300 | 7.0E-26 |
sp|Q8THP1|DAPA_METAC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dapA PE=3 SV=1 | 35 | 267 | 2.0E-25 |
sp|Q9KC32|DAPA1_BACHD | 4-hydroxy-tetrahydrodipicolinate synthase 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dapA1 PE=3 SV=1 | 35 | 308 | 2.0E-25 |
sp|A5FZS7|DAPA_ACICJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidiphilium cryptum (strain JF-5) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-25 |
sp|O29352|DAPA_ARCFU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=dapA PE=3 SV=1 | 26 | 299 | 2.0E-25 |
sp|B8DKU0|DAPA_DESVM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dapA PE=3 SV=1 | 57 | 285 | 3.0E-25 |
sp|Q71ZN5|DAPA_LISMF | 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dapA PE=3 SV=1 | 50 | 263 | 3.0E-25 |
sp|C1L2Z1|DAPA_LISMC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dapA PE=3 SV=1 | 50 | 263 | 3.0E-25 |
sp|B8DE74|DAPA_LISMH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dapA PE=3 SV=1 | 50 | 263 | 4.0E-25 |
sp|A0LDB5|DAPA_MAGMM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dapA PE=3 SV=1 | 26 | 259 | 5.0E-25 |
sp|A0AIN8|DAPA_LISW6 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dapA PE=3 SV=1 | 51 | 263 | 8.0E-25 |
sp|Q8Y766|DAPA_LISMO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dapA PE=3 SV=1 | 50 | 263 | 1.0E-24 |
sp|A1VCZ9|DAPA_DESVV | 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dapA PE=3 SV=1 | 41 | 263 | 1.0E-24 |
sp|Q72AX2|DAPA_DESVH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dapA PE=3 SV=1 | 41 | 263 | 1.0E-24 |
sp|Q92BS0|DAPA_LISIN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dapA PE=3 SV=1 | 50 | 263 | 1.0E-24 |
sp|Q3A1U7|DAPA_PELCD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-24 |
sp|Q9UZ94|DAPAL_PYRAB | Uncharacterized DapA-like lyase PYRAB12600 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=dapAL PE=3 SV=1 | 26 | 302 | 2.0E-24 |
sp|A9NGC2|DAPA_ACHLI | 4-hydroxy-tetrahydrodipicolinate synthase OS=Acholeplasma laidlawii (strain PG-8A) GN=dapA PE=3 SV=1 | 61 | 300 | 1.0E-23 |
sp|B0SL58|DAPA_LEPBP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dapA PE=3 SV=1 | 26 | 291 | 1.0E-23 |
sp|B0SCT0|DAPA_LEPBA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dapA PE=3 SV=1 | 26 | 291 | 1.0E-23 |
sp|A1WZ50|DAPA_HALHL | 4-hydroxy-tetrahydrodipicolinate synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dapA PE=3 SV=1 | 32 | 247 | 1.0E-23 |
sp|Q5FUW9|DAPA_GLUOX | 4-hydroxy-tetrahydrodipicolinate synthase OS=Gluconobacter oxydans (strain 621H) GN=dapA PE=3 SV=2 | 41 | 311 | 1.0E-23 |
sp|C5CHX9|DAPA_KOSOT | 4-hydroxy-tetrahydrodipicolinate synthase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=dapA PE=3 SV=1 | 33 | 248 | 1.0E-23 |
sp|B5YKK4|DAPA_THEYD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-23 |
sp|C0QT41|DAPA_PERMH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=dapA PE=3 SV=1 | 32 | 280 | 2.0E-23 |
sp|Q8EQJ1|DAPA_OCEIH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dapA PE=3 SV=1 | 35 | 263 | 2.0E-23 |
sp|A4XSW1|DAPA_PSEMY | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas mendocina (strain ymp) GN=dapA PE=3 SV=1 | 32 | 247 | 2.0E-23 |
sp|A4VN86|DAPA_PSEU5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas stutzeri (strain A1501) GN=dapA PE=3 SV=1 | 32 | 259 | 2.0E-23 |
sp|A5ULF8|DAPA_METS3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=dapA PE=3 SV=1 | 26 | 302 | 3.0E-23 |
sp|Q8DJK4|DAPA_THEEB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=dapA PE=3 SV=1 | 35 | 301 | 4.0E-23 |
sp|B5EGX4|DAPA_GEOBB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dapA PE=3 SV=1 | 32 | 285 | 4.0E-23 |
sp|Q3J869|DAPA_NITOC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dapA PE=3 SV=1 | 26 | 247 | 4.0E-23 |
sp|Q2NS74|DAPA_SODGM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Sodalis glossinidius (strain morsitans) GN=dapA PE=3 SV=1 | 32 | 263 | 4.0E-23 |
sp|A0LEA7|DAPA_SYNFM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dapA PE=3 SV=1 | 32 | 262 | 5.0E-23 |
sp|C6E9Q9|DAPA_GEOSM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter sp. (strain M21) GN=dapA PE=3 SV=1 | 32 | 285 | 5.0E-23 |
sp|C6BSH4|DAPA_DESAD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dapA PE=3 SV=1 | 57 | 311 | 6.0E-23 |
sp|Q6NGP4|DAPA_CORDI | 4-hydroxy-tetrahydrodipicolinate synthase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=dapA PE=3 SV=1 | 32 | 302 | 7.0E-23 |
sp|Q8Y099|DAPA_RALSO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=dapA PE=3 SV=1 | 55 | 313 | 8.0E-23 |
sp|Q3SJU8|DAPA_THIDA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dapA PE=3 SV=1 | 32 | 247 | 8.0E-23 |
sp|Q9X9W0|DAPA1_STRCO | 4-hydroxy-tetrahydrodipicolinate synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dapA1 PE=3 SV=2 | 35 | 302 | 8.0E-23 |
sp|Q9JZR4|DAPA_NEIMB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=dapA PE=1 SV=1 | 57 | 249 | 9.0E-23 |
sp|Q4FLS1|DAPA_PELUB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pelagibacter ubique (strain HTCC1062) GN=dapA PE=3 SV=1 | 31 | 266 | 9.0E-23 |
sp|A3N0Q9|DAPA_ACTP2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dapA PE=3 SV=1 | 32 | 280 | 1.0E-22 |
sp|Q2RJK7|DAPA_MOOTA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=dapA PE=3 SV=1 | 35 | 302 | 1.0E-22 |
sp|Q49XJ7|DAPA_STAS1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dapA PE=3 SV=1 | 32 | 293 | 1.0E-22 |
sp|Q8UGL3|DAPA_AGRFC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dapA PE=1 SV=1 | 35 | 263 | 1.0E-22 |
sp|B9K865|DAPA_THENN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dapA PE=3 SV=1 | 33 | 259 | 1.0E-22 |
sp|Q92WP0|NANA_RHIME | N-acetylneuraminate lyase OS=Rhizobium meliloti (strain 1021) GN=nanA PE=3 SV=1 | 26 | 318 | 1.0E-22 |
sp|Q4ZW75|DAPA_PSEU2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dapA PE=3 SV=1 | 32 | 247 | 1.0E-22 |
sp|A7MP70|DAPA_CROS8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dapA PE=3 SV=1 | 32 | 259 | 2.0E-22 |
sp|A5GD89|DAPA_GEOUR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter uraniireducens (strain Rf4) GN=dapA PE=3 SV=1 | 32 | 259 | 2.0E-22 |
sp|Q9A900|DAPA_CAUCR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dapA PE=3 SV=1 | 33 | 268 | 2.0E-22 |
sp|B3GXP5|DAPA_ACTP7 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=dapA PE=3 SV=1 | 32 | 280 | 2.0E-22 |
sp|P75682|YAGE_ECOLI | Probable 2-keto-3-deoxy-galactonate aldolase YagE OS=Escherichia coli (strain K12) GN=yagE PE=1 SV=2 | 19 | 254 | 2.0E-22 |
sp|A3DE17|DAPA_CLOTH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-22 |
sp|Q8RQM8|DAPA_COREF | 4-hydroxy-tetrahydrodipicolinate synthase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=dapA PE=3 SV=1 | 27 | 308 | 2.0E-22 |
sp|B3E936|DAPA_GEOLS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dapA PE=3 SV=1 | 32 | 314 | 2.0E-22 |
sp|Q1MPX7|DAPA_LAWIP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=dapA PE=3 SV=2 | 33 | 259 | 2.0E-22 |
sp|Q8U319|DAPAL_PYRFU | Uncharacterized DapA-like lyase PF0657 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=dapAL PE=3 SV=1 | 26 | 328 | 2.0E-22 |
sp|Q1QTP6|DAPA_CHRSD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-22 |
sp|C4L2D2|DAPA_EXISA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dapA PE=3 SV=1 | 35 | 299 | 3.0E-22 |
sp|A1JL07|DAPA_YERE8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dapA PE=3 SV=1 | 32 | 311 | 3.0E-22 |
sp|A1S0T1|DAPAL_THEPD | Uncharacterized DapA-like lyase Tpen_1666 OS=Thermofilum pendens (strain Hrk 5) GN=dapAL PE=3 SV=1 | 26 | 315 | 3.0E-22 |
sp|A1SVX2|DAPA_PSYIN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Psychromonas ingrahamii (strain 37) GN=dapA PE=3 SV=1 | 32 | 302 | 3.0E-22 |
sp|A9HIW2|DAPA_GLUDA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dapA PE=3 SV=1 | 33 | 263 | 4.0E-22 |
sp|Q2JWL7|DAPA_SYNJA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain JA-3-3Ab) GN=dapA PE=3 SV=1 | 35 | 308 | 4.0E-22 |
sp|Q74GT6|DAPA_GEOSL | 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dapA PE=3 SV=1 | 32 | 314 | 4.0E-22 |
sp|A8MF40|DAPA_ALKOO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=dapA PE=3 SV=1 | 32 | 263 | 5.0E-22 |
sp|B1LBR1|DAPA_THESQ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermotoga sp. (strain RQ2) GN=dapA PE=3 SV=1 | 33 | 286 | 5.0E-22 |
sp|C1DD55|DAPA_LARHH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=dapA PE=3 SV=1 | 32 | 263 | 6.0E-22 |
sp|A1ATI8|DAPA_PELPD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pelobacter propionicus (strain DSM 2379) GN=dapA PE=3 SV=1 | 32 | 263 | 6.0E-22 |
sp|Q5WUD4|DAPA_LEGPL | 4-hydroxy-tetrahydrodipicolinate synthase OS=Legionella pneumophila (strain Lens) GN=dapA PE=3 SV=1 | 32 | 318 | 6.0E-22 |
sp|Q5ZT51|DAPA_LEGPH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dapA PE=3 SV=1 | 32 | 318 | 6.0E-22 |
sp|B9M380|DAPA_GEODF | 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-22 |
sp|A0PZM3|DAPA_CLONN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium novyi (strain NT) GN=dapA PE=3 SV=1 | 57 | 263 | 7.0E-22 |
sp|Q21HE7|DAPA_SACD2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dapA PE=3 SV=1 | 32 | 259 | 7.0E-22 |
sp|Q48LD5|DAPA_PSE14 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dapA PE=3 SV=1 | 32 | 307 | 8.0E-22 |
sp|B6YU51|DAPAL_THEON | Uncharacterized DapA-like lyase TON_0506 OS=Thermococcus onnurineus (strain NA1) GN=dapAL PE=3 SV=1 | 26 | 302 | 8.0E-22 |
sp|A4TMN2|DAPA_YERPP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Yersinia pestis (strain Pestoides F) GN=dapA PE=3 SV=2 | 32 | 311 | 9.0E-22 |
sp|Q8ZCD0|DAPA_YERPE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Yersinia pestis GN=dapA PE=3 SV=1 | 32 | 311 | 9.0E-22 |
sp|A7FG49|DAPA_YERP3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dapA PE=3 SV=1 | 32 | 311 | 9.0E-22 |
sp|B3PC19|DAPA_CELJU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Cellvibrio japonicus (strain Ueda107) GN=dapA PE=3 SV=1 | 32 | 259 | 1.0E-21 |
sp|B8GN57|DAPA_THISH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dapA PE=3 SV=1 | 32 | 241 | 1.0E-21 |
sp|Q39Z67|DAPA_GEOMG | 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dapA PE=3 SV=1 | 32 | 285 | 1.0E-21 |
sp|Q9X1K9|DAPA_THEMA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dapA PE=1 SV=1 | 33 | 286 | 1.0E-21 |
sp|A1K4F8|DAPA_AZOSB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Azoarcus sp. (strain BH72) GN=dapA PE=3 SV=1 | 55 | 247 | 1.0E-21 |
sp|A5IM62|DAPA_THEP1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dapA PE=3 SV=1 | 33 | 259 | 1.0E-21 |
sp|B9EBZ6|DAPA_MACCJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Macrococcus caseolyticus (strain JCSC5402) GN=dapA PE=3 SV=1 | 32 | 325 | 1.0E-21 |
sp|Q058B1|DAPA_BUCCC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dapA PE=3 SV=1 | 32 | 262 | 2.0E-21 |
sp|A5IEB3|DAPA_LEGPC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Legionella pneumophila (strain Corby) GN=dapA PE=3 SV=1 | 32 | 318 | 2.0E-21 |
sp|Q668F7|DAPA_YERPS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dapA PE=3 SV=2 | 32 | 311 | 2.0E-21 |
sp|Q5P838|DAPA_AROAE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=dapA PE=3 SV=1 | 55 | 268 | 2.0E-21 |
sp|B0K4I3|DAPA_THEPX | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermoanaerobacter sp. (strain X514) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-21 |
sp|B0KAL7|DAPA_THEP3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-21 |
sp|B9MRD1|DAPA_CALBD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dapA PE=3 SV=1 | 32 | 301 | 2.0E-21 |
sp|Q8TUZ4|DAPA_METKA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=dapA PE=3 SV=1 | 33 | 303 | 2.0E-21 |
sp|Q83CA6|DAPA_COXBU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dapA PE=3 SV=1 | 32 | 242 | 2.0E-21 |
sp|A9NDT3|DAPA_COXBR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dapA PE=3 SV=1 | 32 | 242 | 2.0E-21 |
sp|A9KFS0|DAPA_COXBN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dapA PE=3 SV=1 | 32 | 242 | 2.0E-21 |
sp|A2SIX7|DAPA_METPP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methylibium petroleiphilum (strain PM1) GN=dapA PE=3 SV=1 | 32 | 300 | 2.0E-21 |
sp|P0A6L3|DAPA_SHIFL | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella flexneri GN=dapA PE=3 SV=1 | 32 | 259 | 3.0E-21 |
sp|P0A6L2|DAPA_ECOLI | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli (strain K12) GN=dapA PE=1 SV=1 | 32 | 259 | 3.0E-21 |
sp|B1IWI1|DAPA_ECOLC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dapA PE=3 SV=1 | 32 | 259 | 3.0E-21 |
sp|B7M7I1|DAPA_ECO8A | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O8 (strain IAI1) GN=dapA PE=3 SV=1 | 32 | 259 | 3.0E-21 |
sp|B0BPI4|DAPA_ACTPJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dapA PE=3 SV=1 | 32 | 280 | 3.0E-21 |
sp|Q7VXZ8|DAPA_BORPE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dapA PE=3 SV=1 | 26 | 285 | 3.0E-21 |
sp|A4XJU0|DAPA_CALS8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dapA PE=3 SV=1 | 32 | 301 | 3.0E-21 |
sp|B4RCW4|DAPA_PHEZH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=dapA PE=3 SV=1 | 33 | 272 | 3.0E-21 |
sp|Q053P3|DAPA_LEPBL | 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dapA PE=3 SV=1 | 26 | 288 | 3.0E-21 |
sp|A5D2Q5|DAPA_PELTS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=dapA PE=3 SV=1 | 33 | 318 | 3.0E-21 |
sp|B2V6F1|DAPA_SULSY | 4-hydroxy-tetrahydrodipicolinate synthase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=dapA PE=3 SV=1 | 28 | 280 | 3.0E-21 |
sp|Q3Z7V3|DAPA_DEHM1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dapA PE=3 SV=1 | 35 | 259 | 3.0E-21 |
sp|Q6MDD9|DAPA_PARUW | 4-hydroxy-tetrahydrodipicolinate synthase OS=Protochlamydia amoebophila (strain UWE25) GN=dapA PE=3 SV=1 | 26 | 302 | 4.0E-21 |
sp|Q97GI9|DAPA1_CLOAB | 4-hydroxy-tetrahydrodipicolinate synthase 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dapA1 PE=3 SV=1 | 32 | 309 | 4.0E-21 |
sp|Q92R55|DAPA_RHIME | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhizobium meliloti (strain 1021) GN=dapA PE=3 SV=1 | 35 | 263 | 4.0E-21 |
sp|A9M4C8|DAPA_NEIM0 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=dapA PE=3 SV=1 | 57 | 249 | 4.0E-21 |
sp|A1KTJ9|DAPA_NEIMF | 4-hydroxy-tetrahydrodipicolinate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dapA PE=3 SV=1 | 57 | 249 | 5.0E-21 |
sp|A2SQU8|DAPA_METLZ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=dapA PE=3 SV=1 | 33 | 257 | 5.0E-21 |
sp|Q4QNT3|DAPA_HAEI8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=dapA PE=3 SV=1 | 32 | 279 | 5.0E-21 |
sp|Q9JUU9|DAPA_NEIMA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dapA PE=3 SV=1 | 57 | 249 | 5.0E-21 |
sp|Q3YZ74|DAPA_SHISS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella sonnei (strain Ss046) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|Q31Y13|DAPA_SHIBS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|B2TXQ4|DAPA_SHIB3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|B1LNC8|DAPA_ECOSM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|B6I548|DAPA_ECOSE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli (strain SE11) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|P63943|DAPA_ECOL6 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|A8A2X1|DAPA_ECOHS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O9:H4 (strain HS) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|B7MYB7|DAPA_ECO81 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O81 (strain ED1a) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|B7NQL6|DAPA_ECO7I | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|B5Z015|DAPA_ECO5E | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|P63944|DAPA_ECO57 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O157:H7 GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|B7LCL6|DAPA_ECO55 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|A7ZPS4|DAPA_ECO24 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-21 |
sp|A7Z4U8|DAPA_BACMF | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dapA PE=3 SV=1 | 31 | 256 | 7.0E-21 |
sp|Q04U80|DAPA_LEPBJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dapA PE=3 SV=1 | 26 | 288 | 7.0E-21 |
sp|A9MHQ2|DAPA_SALAR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dapA PE=3 SV=1 | 32 | 259 | 7.0E-21 |
sp|Q9CBW4|DAPA_MYCLE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium leprae (strain TN) GN=dapA PE=3 SV=1 | 33 | 298 | 7.0E-21 |
sp|B8ZRR3|DAPA_MYCLB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium leprae (strain Br4923) GN=dapA PE=3 SV=1 | 33 | 298 | 7.0E-21 |
sp|Q0T239|DAPA_SHIF8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=dapA PE=3 SV=1 | 32 | 259 | 7.0E-21 |
sp|A1W4S3|DAPA_ACISJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidovorax sp. (strain JS42) GN=dapA PE=3 SV=1 | 32 | 311 | 7.0E-21 |
sp|B9MER6|DAPA_ACIET | 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidovorax ebreus (strain TPSY) GN=dapA PE=3 SV=1 | 32 | 311 | 7.0E-21 |
sp|B2VE56|DAPA_ERWT9 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dapA PE=3 SV=1 | 32 | 259 | 8.0E-21 |
sp|A6TCA1|DAPA_KLEP7 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dapA PE=3 SV=1 | 32 | 259 | 8.0E-21 |
sp|A4TCJ3|DAPA_MYCGI | 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=dapA PE=3 SV=1 | 35 | 311 | 8.0E-21 |
sp|C1F658|DAPA_ACIC5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=dapA PE=3 SV=1 | 35 | 319 | 8.0E-21 |
sp|B2FL61|DAPA_STRMK | 4-hydroxy-tetrahydrodipicolinate synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=dapA PE=3 SV=1 | 66 | 320 | 1.0E-20 |
sp|Q8ZN71|DAPA_SALTY | 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dapA PE=1 SV=1 | 32 | 259 | 1.0E-20 |
sp|B4TR62|DAPA_SALSV | 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=dapA PE=3 SV=1 | 32 | 259 | 1.0E-20 |
sp|B5BB16|DAPA_SALPK | 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=dapA PE=3 SV=1 | 32 | 259 | 1.0E-20 |
sp|Q5PLS1|DAPA_SALPA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dapA PE=3 SV=1 | 32 | 259 | 1.0E-20 |
sp|Q5F849|DAPA_NEIG1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dapA PE=3 SV=1 | 57 | 249 | 1.0E-20 |
sp|B7LKG3|DAPA_ESCF3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dapA PE=3 SV=1 | 32 | 259 | 1.0E-20 |
sp|Q8Z4R8|DAPA_SALTI | 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella typhi GN=dapA PE=3 SV=1 | 32 | 259 | 1.0E-20 |
sp|A5UG62|DAPA_HAEIG | 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus influenzae (strain PittGG) GN=dapA PE=3 SV=1 | 32 | 279 | 1.0E-20 |
sp|Q32D87|DAPA_SHIDS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dapA PE=3 SV=1 | 32 | 259 | 1.0E-20 |
sp|B1I383|DAPA_DESAP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulforudis audaxviator (strain MP104C) GN=dapA PE=3 SV=1 | 22 | 299 | 1.0E-20 |
sp|O67216|DAPA_AQUAE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Aquifex aeolicus (strain VF5) GN=dapA PE=1 SV=1 | 32 | 249 | 1.0E-20 |
sp|Q8P9V6|DAPA_XANCP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dapA PE=3 SV=1 | 35 | 308 | 2.0E-20 |
sp|Q8NWS5|DAPA_STAAW | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain MW2) GN=dapA PE=3 SV=1 | 32 | 256 | 2.0E-20 |
sp|Q6G9G6|DAPA_STAAS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain MSSA476) GN=dapA PE=3 SV=1 | 32 | 256 | 2.0E-20 |
sp|B0UVZ8|DAPA_HISS2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Histophilus somni (strain 2336) GN=dapA PE=3 SV=1 | 25 | 259 | 2.0E-20 |
sp|B9DS79|DAPA_STRU0 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dapA PE=3 SV=1 | 33 | 263 | 2.0E-20 |
sp|Q2JQ67|DAPA_SYNJB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=dapA PE=3 SV=1 | 27 | 260 | 2.0E-20 |
sp|Q1WU86|DAPA_LACS1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus salivarius (strain UCC118) GN=dapA PE=3 SV=1 | 33 | 234 | 3.0E-20 |
sp|Q0AI27|DAPA_NITEC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Nitrosomonas eutropha (strain C91) GN=dapA PE=3 SV=1 | 57 | 247 | 3.0E-20 |
sp|Q47HS9|DAPA_DECAR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Dechloromonas aromatica (strain RCB) GN=dapA PE=3 SV=1 | 57 | 247 | 3.0E-20 |
sp|Q2NHW2|DAPA_METST | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=dapA PE=3 SV=1 | 26 | 264 | 3.0E-20 |
sp|B6IN13|DAPA_RHOCS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dapA PE=3 SV=1 | 32 | 274 | 3.0E-20 |
sp|O58577|DAPAL_PYRHO | Uncharacterized DapA-like lyase PH0847 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=dapAL PE=3 SV=1 | 26 | 302 | 3.0E-20 |
sp|Q2YXX4|DAPA_STAAB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dapA PE=3 SV=1 | 32 | 256 | 3.0E-20 |
sp|Q5PB64|DAPA_ANAMM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaplasma marginale (strain St. Maries) GN=dapA PE=3 SV=1 | 26 | 267 | 3.0E-20 |
sp|B9KI57|DAPA_ANAMF | 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaplasma marginale (strain Florida) GN=dapA PE=3 SV=1 | 26 | 267 | 3.0E-20 |
sp|Q8PLN5|DAPA_XANAC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dapA PE=3 SV=1 | 35 | 308 | 4.0E-20 |
sp|A1U1A6|DAPA_MARHV | 4-hydroxy-tetrahydrodipicolinate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dapA PE=3 SV=1 | 26 | 301 | 4.0E-20 |
sp|B9DP23|DAPA_STACT | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus carnosus (strain TM300) GN=dapA PE=3 SV=1 | 32 | 260 | 4.0E-20 |
sp|A8Z3X3|DAPA_STAAT | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dapA PE=3 SV=1 | 32 | 256 | 4.0E-20 |
sp|A6QGU6|DAPA_STAAE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain Newman) GN=dapA PE=3 SV=1 | 32 | 256 | 4.0E-20 |
sp|Q5HG25|DAPA_STAAC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain COL) GN=dapA PE=1 SV=1 | 32 | 256 | 4.0E-20 |
sp|Q9EZ12|DAPA_STAA8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=dapA PE=3 SV=1 | 32 | 256 | 4.0E-20 |
sp|Q2FH43|DAPA_STAA3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain USA300) GN=dapA PE=3 SV=1 | 32 | 256 | 4.0E-20 |
sp|Q04FS1|DAPA_OENOB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=dapA PE=3 SV=1 | 33 | 299 | 4.0E-20 |
sp|Q8DUE5|DAPA_STRMU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dapA PE=3 SV=1 | 33 | 234 | 5.0E-20 |
sp|P39359|YJHH_ECOLI | Uncharacterized lyase YjhH OS=Escherichia coli (strain K12) GN=yjhH PE=3 SV=2 | 26 | 254 | 5.0E-20 |
sp|A5UAN5|DAPA_HAEIE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus influenzae (strain PittEE) GN=dapA PE=3 SV=1 | 32 | 279 | 5.0E-20 |
sp|O26892|DAPA_METTH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dapA PE=3 SV=1 | 26 | 261 | 5.0E-20 |
sp|A6H0M8|DAPA_FLAPJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=dapA PE=3 SV=1 | 32 | 263 | 6.0E-20 |
sp|Q21WN2|DAPA_RHOFT | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=dapA PE=3 SV=1 | 32 | 311 | 6.0E-20 |
sp|Q2Y8S8|DAPA_NITMU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dapA PE=3 SV=1 | 32 | 247 | 6.0E-20 |
sp|B0THT2|DAPA_HELMI | 4-hydroxy-tetrahydrodipicolinate synthase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=dapA PE=3 SV=1 | 33 | 319 | 7.0E-20 |
sp|Q310Q2|DAPA_DESAG | 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfovibrio alaskensis (strain G20) GN=dapA PE=3 SV=1 | 33 | 254 | 7.0E-20 |
sp|Q6GH13|DAPA_STAAR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain MRSA252) GN=dapA PE=1 SV=1 | 32 | 256 | 9.0E-20 |
sp|Q0I260|DAPA_HAES1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus somnus (strain 129Pt) GN=dapA PE=3 SV=1 | 25 | 259 | 1.0E-19 |
sp|Q04796|DAPA_BACSU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bacillus subtilis (strain 168) GN=dapA PE=1 SV=1 | 31 | 259 | 1.0E-19 |
sp|P43797|DAPA_HAEIN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dapA PE=3 SV=1 | 32 | 279 | 1.0E-19 |
sp|Q7MIL2|DAPA_VIBVY | 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio vulnificus (strain YJ016) GN=dapA PE=3 SV=2 | 32 | 259 | 1.0E-19 |
sp|B6YQ20|DAPA_AZOPC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=dapA PE=3 SV=1 | 32 | 285 | 1.0E-19 |
sp|B2GC11|DAPA_LACF3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dapA PE=3 SV=1 | 35 | 310 | 1.0E-19 |
sp|Q89AY0|DAPA_BUCBP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dapA PE=3 SV=1 | 57 | 250 | 2.0E-19 |
sp|Q0VRH4|DAPA_ALCBS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dapA PE=3 SV=1 | 32 | 259 | 2.0E-19 |
sp|A1US27|DAPA_BARBK | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dapA PE=3 SV=1 | 35 | 256 | 2.0E-19 |
sp|A5FQT5|DAPA_DEHMB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dapA PE=3 SV=1 | 35 | 259 | 2.0E-19 |
sp|O86841|DAPA2_STRCO | 4-hydroxy-tetrahydrodipicolinate synthase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dapA2 PE=3 SV=1 | 27 | 302 | 2.0E-19 |
sp|Q5HPE7|DAPA_STAEQ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dapA PE=3 SV=1 | 32 | 314 | 2.0E-19 |
sp|Q3ZXV3|DAPA_DEHMC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=dapA PE=3 SV=1 | 35 | 259 | 2.0E-19 |
sp|Q73VZ7|DAPA_MYCPA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dapA PE=3 SV=1 | 27 | 311 | 2.0E-19 |
sp|B4SRX7|DAPA_STRM5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=dapA PE=3 SV=1 | 66 | 320 | 2.0E-19 |
sp|Q15SZ4|DAPA_PSEA6 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dapA PE=3 SV=1 | 26 | 268 | 2.0E-19 |
sp|P63948|DAPA_STAAN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain N315) GN=dapA PE=3 SV=1 | 32 | 256 | 2.0E-19 |
sp|P63947|DAPA_STAAM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapA PE=3 SV=1 | 32 | 256 | 2.0E-19 |
sp|A5ISS7|DAPA_STAA9 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain JH9) GN=dapA PE=3 SV=1 | 32 | 256 | 2.0E-19 |
sp|A6U1L6|DAPA_STAA2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain JH1) GN=dapA PE=3 SV=1 | 32 | 256 | 2.0E-19 |
sp|A7X271|DAPA_STAA1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dapA PE=3 SV=1 | 32 | 256 | 2.0E-19 |
sp|A0LZ30|DAPA_GRAFK | 4-hydroxy-tetrahydrodipicolinate synthase OS=Gramella forsetii (strain KT0803) GN=dapA PE=3 SV=1 | 32 | 275 | 3.0E-19 |
sp|C5B7A2|DAPA_EDWI9 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=dapA PE=3 SV=1 | 32 | 263 | 3.0E-19 |
sp|P9WP25|DAPA_MYCTU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dapA PE=1 SV=1 | 35 | 309 | 3.0E-19 |
sp|P9WP24|DAPA_MYCTO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dapA PE=3 SV=1 | 35 | 309 | 3.0E-19 |
sp|A5U6A6|DAPA_MYCTA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=dapA PE=3 SV=1 | 35 | 309 | 3.0E-19 |
sp|C1AFL5|DAPA_MYCBT | 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=dapA PE=3 SV=1 | 35 | 309 | 3.0E-19 |
sp|A1KM94|DAPA_MYCBP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=dapA PE=3 SV=1 | 35 | 309 | 3.0E-19 |
sp|P63946|DAPA_MYCBO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dapA PE=3 SV=1 | 35 | 309 | 3.0E-19 |
sp|B1JDB7|DAPA_PSEPW | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas putida (strain W619) GN=dapA PE=3 SV=1 | 32 | 259 | 4.0E-19 |
sp|Q891S3|DAPA_CLOTE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=dapA PE=3 SV=1 | 61 | 263 | 6.0E-19 |
sp|Q82SD7|DAPA_NITEU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dapA PE=3 SV=1 | 60 | 247 | 6.0E-19 |
sp|Q8CP96|DAPA_STAES | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dapA PE=3 SV=1 | 32 | 314 | 7.0E-19 |
sp|Q1GSC8|DAPA_SPHAL | 4-hydroxy-tetrahydrodipicolinate synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=dapA PE=3 SV=1 | 40 | 311 | 7.0E-19 |
sp|Q07M65|DAPA_RHOP5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=dapA PE=3 SV=1 | 33 | 311 | 7.0E-19 |
sp|A4SG05|DAPA_CHLPM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dapA PE=3 SV=1 | 32 | 262 | 8.0E-19 |
sp|Q8DBB0|DAPA_VIBVU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio vulnificus (strain CMCP6) GN=dapA PE=3 SV=1 | 32 | 259 | 8.0E-19 |
sp|B8D702|DAPA_BUCAT | 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dapA PE=3 SV=1 | 32 | 247 | 9.0E-19 |
sp|P57197|DAPA_BUCAI | 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dapA PE=3 SV=1 | 32 | 247 | 9.0E-19 |
sp|Q3B2G4|DAPA_CHLL7 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dapA PE=3 SV=1 | 32 | 311 | 1.0E-18 |
sp|A4J5V5|DAPA_DESRM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=dapA PE=3 SV=1 | 22 | 286 | 1.0E-18 |
sp|Q07607|DAPA_RHIML | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhizobium meliloti GN=dapA PE=1 SV=2 | 33 | 263 | 1.0E-18 |
sp|B1YJ39|DAPA_EXIS2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dapA PE=3 SV=1 | 35 | 299 | 1.0E-18 |
sp|A6UVG7|DAPA_META3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=dapA PE=3 SV=1 | 33 | 259 | 1.0E-18 |
sp|B8D8P8|DAPA_BUCA5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dapA PE=3 SV=1 | 32 | 247 | 1.0E-18 |
sp|A6US71|DAPA_METVS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=dapA PE=3 SV=1 | 26 | 310 | 1.0E-18 |
sp|P58207|DAPA_RHILO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhizobium loti (strain MAFF303099) GN=dapA PE=3 SV=1 | 57 | 263 | 1.0E-18 |
sp|Q9KA91|DAPA2_BACHD | 4-hydroxy-tetrahydrodipicolinate synthase 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dapA2 PE=3 SV=1 | 33 | 307 | 2.0E-18 |
sp|Q6AR63|DAPA_DESPS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dapA PE=3 SV=1 | 26 | 263 | 2.0E-18 |
sp|Q60B13|DAPA_METCA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dapA PE=3 SV=1 | 32 | 254 | 2.0E-18 |
sp|Q8RBI5|DAPA_CALS4 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-18 |
sp|Q9CLZ7|DAPA_PASMU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pasteurella multocida (strain Pm70) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-18 |
sp|A4WNS1|DAPA_RHOS5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dapA PE=3 SV=1 | 33 | 272 | 2.0E-18 |
sp|B4UHY1|DAPA_ANASK | 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaeromyxobacter sp. (strain K) GN=dapA PE=3 SV=1 | 32 | 248 | 2.0E-18 |
sp|B9KY71|DAPA_THERP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dapA PE=3 SV=1 | 32 | 264 | 3.0E-18 |
sp|B1Y7F0|DAPA_LEPCP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dapA PE=3 SV=1 | 32 | 259 | 3.0E-18 |
sp|Q5NPL6|DAPA_ZYMMO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dapA PE=3 SV=1 | 49 | 263 | 3.0E-18 |
sp|Q8YQY1|DAPA_NOSS1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dapA PE=3 SV=1 | 33 | 262 | 3.0E-18 |
sp|A0LV15|DAPA_ACIC1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=dapA PE=3 SV=1 | 27 | 316 | 3.0E-18 |
sp|Q2IGX5|DAPA_ANADE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=dapA PE=3 SV=1 | 32 | 248 | 4.0E-18 |
sp|Q7VRT1|DAPA_BLOFL | 4-hydroxy-tetrahydrodipicolinate synthase OS=Blochmannia floridanus GN=dapA PE=3 SV=1 | 32 | 242 | 4.0E-18 |
sp|A5F699|DAPA_VIBC3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dapA PE=3 SV=1 | 26 | 263 | 4.0E-18 |
sp|A4SX51|DAPA_POLSQ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=dapA PE=3 SV=1 | 57 | 313 | 4.0E-18 |
sp|Q6MRM9|DAPA_BDEBA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dapA PE=3 SV=1 | 33 | 259 | 4.0E-18 |
sp|P19808|DAPA_CORGL | 4-hydroxy-tetrahydrodipicolinate synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=dapA PE=1 SV=2 | 27 | 309 | 5.0E-18 |
sp|Q87AT3|DAPA_XYLFT | 4-hydroxy-tetrahydrodipicolinate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dapA PE=3 SV=1 | 33 | 300 | 5.0E-18 |
sp|C3LPG2|DAPA_VIBCM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dapA PE=3 SV=1 | 26 | 259 | 5.0E-18 |
sp|Q9KQ47|DAPA_VIBCH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dapA PE=3 SV=1 | 26 | 259 | 5.0E-18 |
sp|Q03YE2|DAPA_LEUMM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=dapA PE=3 SV=1 | 35 | 263 | 6.0E-18 |
sp|Q0BYG4|DAPA_HYPNA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=dapA PE=3 SV=1 | 33 | 244 | 7.0E-18 |
sp|B8JAN5|DAPA_ANAD2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=dapA PE=3 SV=1 | 32 | 248 | 8.0E-18 |
sp|Q5E3I3|DAPA_VIBF1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dapA PE=3 SV=1 | 32 | 259 | 9.0E-18 |
sp|Q1QL43|DAPA_NITHX | 4-hydroxy-tetrahydrodipicolinate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=dapA PE=3 SV=1 | 57 | 307 | 1.0E-17 |
sp|Q8KA24|DAPA_BUCAP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dapA PE=3 SV=1 | 60 | 247 | 1.0E-17 |
sp|Q0TP55|DAPA_CLOP1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=dapA PE=3 SV=1 | 32 | 298 | 1.0E-17 |
sp|A5FE82|DAPA_FLAJ1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=dapA PE=3 SV=1 | 32 | 278 | 1.0E-17 |
sp|Q11JT7|DAPA_CHESB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Chelativorans sp. (strain BNC1) GN=dapA PE=3 SV=1 | 55 | 263 | 1.0E-17 |
sp|Q7VM87|DAPA_HAEDU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dapA PE=3 SV=1 | 32 | 280 | 1.0E-17 |
sp|Q9PER5|DAPA_XYLFA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Xylella fastidiosa (strain 9a5c) GN=dapA PE=3 SV=2 | 33 | 300 | 1.0E-17 |
sp|B5FGX4|DAPA_VIBFM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio fischeri (strain MJ11) GN=dapA PE=3 SV=1 | 32 | 259 | 1.0E-17 |
sp|Q8XJ56|DAPA_CLOPE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium perfringens (strain 13 / Type A) GN=dapA PE=3 SV=1 | 32 | 298 | 1.0E-17 |
sp|B8HYL7|DAPA_CYAP4 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=dapA PE=3 SV=1 | 35 | 301 | 2.0E-17 |
sp|C5BQD1|DAPA_TERTT | 4-hydroxy-tetrahydrodipicolinate synthase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dapA PE=3 SV=1 | 32 | 311 | 2.0E-17 |
sp|Q4JV64|DAPA_CORJK | 4-hydroxy-tetrahydrodipicolinate synthase OS=Corynebacterium jeikeium (strain K411) GN=dapA PE=3 SV=1 | 35 | 308 | 2.0E-17 |
sp|A9FHA5|DAPA_SORC5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Sorangium cellulosum (strain So ce56) GN=dapA PE=3 SV=1 | 26 | 254 | 2.0E-17 |
sp|B8CMS5|DAPA_SHEPW | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-17 |
sp|Q0A5S1|DAPA_ALKEH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dapA PE=3 SV=1 | 26 | 267 | 2.0E-17 |
sp|Q0SRS5|DAPA_CLOPS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=dapA PE=3 SV=1 | 32 | 298 | 3.0E-17 |
sp|C1CK93|DAPA_STRZP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain P1031) GN=dapA PE=3 SV=1 | 33 | 288 | 3.0E-17 |
sp|C1C6Z0|DAPA_STRP7 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain 70585) GN=dapA PE=3 SV=1 | 33 | 288 | 3.0E-17 |
sp|Q97R25|DAPA_STRPN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dapA PE=1 SV=1 | 33 | 288 | 3.0E-17 |
sp|B1IBH4|DAPA_STRPI | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=dapA PE=3 SV=1 | 33 | 288 | 3.0E-17 |
sp|B5E4D5|DAPA_STRP4 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=dapA PE=3 SV=1 | 33 | 288 | 3.0E-17 |
sp|B0C142|DAPA_ACAM1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=dapA PE=3 SV=1 | 35 | 263 | 4.0E-17 |
sp|A3CN43|DAPA_STRSV | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus sanguinis (strain SK36) GN=dapA PE=3 SV=1 | 33 | 234 | 4.0E-17 |
sp|B2IT87|DAPA_NOSP7 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=dapA PE=3 SV=1 | 33 | 263 | 5.0E-17 |
sp|A4G724|DAPA_HERAR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Herminiimonas arsenicoxydans GN=dapA PE=3 SV=1 | 32 | 264 | 5.0E-17 |
sp|B2RMB9|DAPA_PORG3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dapA PE=3 SV=1 | 32 | 263 | 6.0E-17 |
sp|B6EJT2|DAPA_ALISL | 4-hydroxy-tetrahydrodipicolinate synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-17 |
sp|Q5MZT3|DAPA_SYNP6 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dapA PE=3 SV=1 | 33 | 298 | 6.0E-17 |
sp|Q31M42|DAPA_SYNE7 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus elongatus (strain PCC 7942) GN=dapA PE=3 SV=1 | 33 | 298 | 6.0E-17 |
sp|A1AVV3|DAPA_RUTMC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dapA PE=3 SV=1 | 56 | 242 | 6.0E-17 |
sp|Q8G527|DAPA_BIFLO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bifidobacterium longum (strain NCC 2705) GN=dapA PE=3 SV=1 | 40 | 286 | 6.0E-17 |
sp|B3DTC8|DAPA_BIFLD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bifidobacterium longum (strain DJO10A) GN=dapA PE=3 SV=1 | 40 | 286 | 6.0E-17 |
sp|Q02XU7|DAPA_LACLS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=dapA PE=3 SV=1 | 35 | 263 | 6.0E-17 |
sp|A4FYQ3|DAPA_METM5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=dapA PE=3 SV=1 | 26 | 310 | 7.0E-17 |
sp|A8LKQ5|DAPA_DINSH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=dapA PE=3 SV=1 | 33 | 263 | 7.0E-17 |
sp|C4K288|DAPA_RICPU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia peacockii (strain Rustic) GN=dapA PE=3 SV=1 | 33 | 263 | 8.0E-17 |
sp|A5VPI5|DAPA_BRUO2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dapA PE=3 SV=1 | 33 | 263 | 8.0E-17 |
sp|Q8YG60|DAPA_BRUME | 4-hydroxy-tetrahydrodipicolinate synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dapA PE=3 SV=2 | 33 | 263 | 8.0E-17 |
sp|Q57E96|DAPA_BRUAB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=dapA PE=3 SV=1 | 33 | 263 | 8.0E-17 |
sp|B4S5J5|DAPA_PROA2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dapA PE=3 SV=1 | 32 | 264 | 8.0E-17 |
sp|Q9CF61|DAPA_LACLA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dapA PE=3 SV=1 | 35 | 263 | 9.0E-17 |
sp|B5ELM5|DAPA_ACIF5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dapA PE=3 SV=1 | 32 | 254 | 9.0E-17 |
sp|B7J6C4|DAPA_ACIF2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dapA PE=3 SV=1 | 32 | 254 | 9.0E-17 |
sp|Q492F5|DAPA_BLOPB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Blochmannia pennsylvanicus (strain BPEN) GN=dapA PE=3 SV=1 | 32 | 252 | 1.0E-16 |
sp|Q4L6A0|DAPA_STAHJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dapA PE=3 SV=1 | 32 | 256 | 1.0E-16 |
sp|Q6AA18|DAPA_PROAC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dapA PE=3 SV=1 | 40 | 278 | 1.0E-16 |
sp|Q57695|DAPA_METJA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dapA PE=1 SV=1 | 26 | 259 | 1.0E-16 |
sp|A9A656|DAPA_METM6 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=dapA PE=3 SV=1 | 26 | 259 | 1.0E-16 |
sp|A8GS25|DAPA_RICRS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia rickettsii (strain Sheila Smith) GN=dapA PE=3 SV=1 | 33 | 263 | 1.0E-16 |
sp|B0BXJ1|DAPA_RICRO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia rickettsii (strain Iowa) GN=dapA PE=3 SV=1 | 33 | 263 | 1.0E-16 |
sp|Q9AKJ9|DAPA_RICRI | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia rickettsii GN=dapA PE=3 SV=1 | 33 | 263 | 1.0E-16 |
sp|Q28WG2|DAPA_JANSC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Jannaschia sp. (strain CCS1) GN=dapA PE=3 SV=2 | 33 | 263 | 2.0E-16 |
sp|C1CE08|DAPA_STRZJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain JJA) GN=dapA PE=3 SV=1 | 33 | 288 | 2.0E-16 |
sp|B8ZPG7|DAPA_STRPJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dapA PE=3 SV=1 | 33 | 288 | 2.0E-16 |
sp|B4U7D7|DAPA_HYDS0 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=dapA PE=3 SV=1 | 57 | 246 | 2.0E-16 |
sp|A8F1K3|DAPA_RICM5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia massiliae (strain Mtu5) GN=dapA PE=3 SV=1 | 33 | 263 | 2.0E-16 |
sp|Q92I25|DAPA_RICCN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dapA PE=3 SV=1 | 33 | 263 | 2.0E-16 |
sp|Q8G1R0|DAPA_BRUSU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Brucella suis biovar 1 (strain 1330) GN=dapA PE=3 SV=1 | 33 | 263 | 3.0E-16 |
sp|A9KHY6|DAPA_CLOPH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dapA PE=3 SV=1 | 57 | 263 | 3.0E-16 |
sp|B1GYN1|DAPA_UNCTG | 4-hydroxy-tetrahydrodipicolinate synthase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=dapA PE=3 SV=1 | 26 | 263 | 3.0E-16 |
sp|C3PNF5|DAPA_RICAE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia africae (strain ESF-5) GN=dapA PE=3 SV=1 | 33 | 263 | 3.0E-16 |
sp|Q9AKQ3|DAPA_RICMO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia montanensis GN=dapA PE=3 SV=1 | 33 | 263 | 3.0E-16 |
sp|Q5QU03|DAPA_IDILO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dapA PE=3 SV=1 | 26 | 323 | 4.0E-16 |
sp|A6VJM9|DAPA_METM7 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=dapA PE=3 SV=1 | 33 | 263 | 4.0E-16 |
sp|Q1RIJ3|DAPA_RICBR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia bellii (strain RML369-C) GN=dapA PE=3 SV=1 | 33 | 247 | 4.0E-16 |
sp|Q03HT2|DAPA_PEDPA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dapA PE=3 SV=1 | 33 | 234 | 4.0E-16 |
sp|Q5LMK7|DAPA_RUEPO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dapA PE=3 SV=1 | 33 | 287 | 5.0E-16 |
sp|Q55513|DAPA_SYNY3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dapA PE=3 SV=1 | 33 | 263 | 5.0E-16 |
sp|B3QM33|DAPA_CHLP8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=dapA PE=3 SV=1 | 31 | 259 | 6.0E-16 |
sp|O05969|DAPA_RICPR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia prowazekii (strain Madrid E) GN=dapA PE=3 SV=1 | 33 | 252 | 6.0E-16 |
sp|B1VDC4|DAPA_CORU7 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=dapA PE=3 SV=1 | 27 | 324 | 6.0E-16 |
sp|B9KFX0|DAPA_CAMLR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dapA PE=3 SV=1 | 33 | 263 | 6.0E-16 |
sp|C0R176|DAPA_BRAHW | 4-hydroxy-tetrahydrodipicolinate synthase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=dapA PE=3 SV=1 | 35 | 304 | 7.0E-16 |
sp|A6LA57|DAPA_PARD8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=dapA PE=3 SV=1 | 32 | 259 | 7.0E-16 |
sp|B8DWI2|DAPA_BIFA0 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=dapA PE=3 SV=1 | 35 | 286 | 7.0E-16 |
sp|Q9RH76|DAPA_BRADU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dapA PE=3 SV=2 | 57 | 263 | 7.0E-16 |
sp|Q03K16|DAPA_STRTD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dapA PE=3 SV=1 | 33 | 234 | 8.0E-16 |
sp|B2IPH2|DAPA_STRPS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=dapA PE=3 SV=1 | 33 | 288 | 8.0E-16 |
sp|Q8DPZ9|DAPA_STRR6 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dapA PE=3 SV=1 | 33 | 234 | 8.0E-16 |
sp|Q04KR9|DAPA_STRP2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dapA PE=3 SV=1 | 33 | 234 | 8.0E-16 |
sp|B4SE03|DAPA_PELPB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=dapA PE=3 SV=1 | 32 | 311 | 9.0E-16 |
sp|A1RKF2|DAPA_SHESW | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella sp. (strain W3-18-1) GN=dapA PE=3 SV=1 | 32 | 263 | 9.0E-16 |
sp|A4Y644|DAPA_SHEPC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dapA PE=3 SV=1 | 32 | 263 | 9.0E-16 |
sp|Q7M7L6|DAPA_WOLSU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dapA PE=3 SV=1 | 33 | 285 | 1.0E-15 |
sp|A6LP58|DAPA_THEM4 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dapA PE=3 SV=1 | 58 | 251 | 1.0E-15 |
sp|C1CRD6|DAPA_STRZT | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dapA PE=3 SV=1 | 33 | 234 | 1.0E-15 |
sp|Q16BK4|DAPA_ROSDO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dapA PE=3 SV=1 | 33 | 287 | 1.0E-15 |
sp|A2RJL6|DAPA_LACLM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dapA PE=3 SV=1 | 35 | 263 | 1.0E-15 |
sp|A4VU96|DAPA_STRSY | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus suis (strain 05ZYH33) GN=dapA PE=3 SV=1 | 35 | 299 | 1.0E-15 |
sp|A4W0I7|DAPA_STRS2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus suis (strain 98HAH33) GN=dapA PE=3 SV=1 | 35 | 299 | 1.0E-15 |
sp|Q2LTA1|DAPA_SYNAS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Syntrophus aciditrophicus (strain SB) GN=dapA PE=3 SV=2 | 57 | 285 | 2.0E-15 |
sp|Q6LZP8|DAPA_METMP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=dapA PE=3 SV=1 | 26 | 259 | 2.0E-15 |
sp|Q8KC06|DAPA_CHLTE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dapA PE=3 SV=1 | 32 | 259 | 2.0E-15 |
sp|A7HJ56|DAPA_FERNB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=dapA PE=3 SV=2 | 33 | 265 | 2.0E-15 |
sp|Q836D1|DAPA_ENTFA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dapA PE=3 SV=1 | 35 | 263 | 3.0E-15 |
sp|A7H773|DAPA_ANADF | 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=dapA PE=3 SV=1 | 32 | 263 | 3.0E-15 |
sp|A8GWS1|DAPA_RICB8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia bellii (strain OSU 85-389) GN=dapA PE=3 SV=1 | 33 | 247 | 3.0E-15 |
sp|Q3B0T8|DAPA_SYNS9 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain CC9902) GN=dapA PE=3 SV=1 | 33 | 301 | 3.0E-15 |
sp|A6W828|DAPA_KINRD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=dapA PE=3 SV=1 | 52 | 286 | 3.0E-15 |
sp|A5V3L9|DAPA_SPHWW | 4-hydroxy-tetrahydrodipicolinate synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dapA PE=3 SV=2 | 55 | 263 | 4.0E-15 |
sp|Q0IE16|DAPA_SYNS3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain CC9311) GN=dapA PE=3 SV=1 | 18 | 298 | 5.0E-15 |
sp|B6JGA4|DAPA_OLICO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dapA PE=3 SV=1 | 55 | 263 | 5.0E-15 |
sp|A8FLL9|DAPA_CAMJ8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=dapA PE=3 SV=1 | 33 | 241 | 5.0E-15 |
sp|Q9PPB4|DAPA_CAMJE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=dapA PE=1 SV=1 | 33 | 241 | 5.0E-15 |
sp|A8AXI2|DAPA_STRGC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dapA PE=3 SV=1 | 33 | 234 | 6.0E-15 |
sp|B3EH29|DAPA_CHLL2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dapA PE=3 SV=1 | 32 | 259 | 6.0E-15 |
sp|Q6LN85|DAPA_PHOPR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Photobacterium profundum GN=dapA PE=3 SV=2 | 32 | 300 | 6.0E-15 |
sp|Q5HUY6|DAPA_CAMJR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter jejuni (strain RM1221) GN=dapA PE=3 SV=1 | 33 | 241 | 7.0E-15 |
sp|A1VZF4|DAPA_CAMJJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=dapA PE=3 SV=1 | 33 | 241 | 7.0E-15 |
sp|Q1INQ6|DAPA_KORVE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Koribacter versatilis (strain Ellin345) GN=dapA PE=3 SV=1 | 56 | 249 | 7.0E-15 |
sp|Q8EFT7|DAPA_SHEON | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella oneidensis (strain MR-1) GN=dapA PE=3 SV=1 | 32 | 263 | 7.0E-15 |
sp|A7H443|DAPA_CAMJD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=dapA PE=3 SV=1 | 33 | 241 | 8.0E-15 |
sp|A0KVS0|DAPA_SHESA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella sp. (strain ANA-3) GN=dapA PE=3 SV=1 | 32 | 263 | 8.0E-15 |
sp|A8EYZ4|DAPA_RICCK | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia canadensis (strain McKiel) GN=dapA PE=3 SV=1 | 39 | 263 | 8.0E-15 |
sp|A7I0Y0|DAPA_CAMHC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dapA PE=3 SV=1 | 32 | 241 | 1.0E-14 |
sp|Q9HJ17|DAPAL_THEAC | Uncharacterized DapA-like lyase Ta1157 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dapAL PE=3 SV=1 | 26 | 263 | 1.0E-14 |
sp|Q6G091|DAPA_BARQU | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bartonella quintana (strain Toulouse) GN=dapA PE=3 SV=1 | 33 | 298 | 1.0E-14 |
sp|Q9AKE4|DAPA_RICTY | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dapA PE=3 SV=1 | 58 | 252 | 1.0E-14 |
sp|Q0HU08|DAPA_SHESR | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella sp. (strain MR-7) GN=dapA PE=3 SV=1 | 32 | 263 | 1.0E-14 |
sp|Q0HHQ6|DAPA_SHESM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella sp. (strain MR-4) GN=dapA PE=3 SV=1 | 32 | 263 | 1.0E-14 |
sp|A8YUT3|DAPA_LACH4 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus helveticus (strain DPC 4571) GN=dapA PE=3 SV=1 | 23 | 263 | 1.0E-14 |
sp|A7GYB0|DAPA_CAMC5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter curvus (strain 525.92) GN=dapA PE=3 SV=1 | 33 | 250 | 1.0E-14 |
sp|Q3APU0|DAPA_CHLCH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=dapA PE=3 SV=1 | 32 | 311 | 1.0E-14 |
sp|A9L573|DAPA_SHEB9 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella baltica (strain OS195) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-14 |
sp|A6WPI6|DAPA_SHEB8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella baltica (strain OS185) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-14 |
sp|A3D5N2|DAPA_SHEB5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-14 |
sp|B8E724|DAPA_SHEB2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella baltica (strain OS223) GN=dapA PE=3 SV=1 | 32 | 263 | 2.0E-14 |
sp|Q5FKQ9|DAPA_LACAC | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dapA PE=3 SV=1 | 23 | 253 | 2.0E-14 |
sp|Q4FVD6|DAPA_PSYA2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dapA PE=3 SV=1 | 32 | 266 | 4.0E-14 |
sp|B0JL91|DAPA_MICAN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=dapA PE=3 SV=1 | 35 | 300 | 4.0E-14 |
sp|A7HX36|DAPA_PARL1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dapA PE=3 SV=1 | 32 | 263 | 4.0E-14 |
sp|Q46ID7|DAPA_PROMT | 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain NATL2A) GN=dapA PE=3 SV=1 | 33 | 324 | 5.0E-14 |
sp|Q317Y9|DAPA_PROM9 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=dapA PE=3 SV=1 | 35 | 311 | 5.0E-14 |
sp|Q2N9J7|DAPA_ERYLH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=dapA PE=3 SV=1 | 40 | 246 | 6.0E-14 |
sp|A5WHC3|DAPA_PSYWF | 4-hydroxy-tetrahydrodipicolinate synthase OS=Psychrobacter sp. (strain PRwf-1) GN=dapA PE=3 SV=1 | 13 | 247 | 6.0E-14 |
sp|A6L5G7|DAPA_BACV8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=dapA PE=3 SV=1 | 32 | 250 | 7.0E-14 |
sp|C3PH04|DAPA_CORA7 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=dapA PE=3 SV=1 | 32 | 309 | 8.0E-14 |
sp|A8Z624|DAPA_SULMW | 4-hydroxy-tetrahydrodipicolinate synthase OS=Sulcia muelleri (strain GWSS) GN=dapA PE=3 SV=1 | 32 | 262 | 8.0E-14 |
sp|A8G7F8|DAPA_PROM2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=dapA PE=3 SV=1 | 35 | 300 | 9.0E-14 |
sp|B7IF13|DAPA_THEAB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermosipho africanus (strain TCF52B) GN=dapA PE=3 SV=1 | 33 | 285 | 9.0E-14 |
sp|Q2G8D6|DAPA_NOVAD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=dapA PE=3 SV=1 | 57 | 320 | 1.0E-13 |
sp|Q4ULR2|DAPA_RICFE | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dapA PE=3 SV=1 | 39 | 263 | 1.0E-13 |
sp|A5GQ13|DAPA_SYNR3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain RCC307) GN=dapA PE=3 SV=1 | 27 | 298 | 1.0E-13 |
sp|A2BTN4|DAPA_PROMS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain AS9601) GN=dapA PE=3 SV=1 | 35 | 311 | 1.0E-13 |
sp|B3EMS4|DAPA_CHLPB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium phaeobacteroides (strain BS1) GN=dapA PE=3 SV=1 | 32 | 259 | 2.0E-13 |
sp|A9IRK3|DAPA_BART1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dapA PE=3 SV=1 | 33 | 247 | 2.0E-13 |
sp|A3PFE1|DAPA_PROM0 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=dapA PE=3 SV=1 | 35 | 311 | 2.0E-13 |
sp|Q082V3|DAPA_SHEFN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=dapA PE=3 SV=1 | 32 | 243 | 2.0E-13 |
sp|Q11VI2|DAPA_CYTH3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=dapA PE=3 SV=1 | 35 | 262 | 3.0E-13 |
sp|O25657|DAPA_HELPY | 4-hydroxy-tetrahydrodipicolinate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dapA PE=3 SV=1 | 51 | 264 | 3.0E-13 |
sp|Q97D80|DAPA2_CLOAB | 4-hydroxy-tetrahydrodipicolinate synthase 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dapA2 PE=3 SV=1 | 26 | 258 | 4.0E-13 |
sp|O69782|DAPAL_RHIML | Uncharacterized DapA-like lyase OS=Rhizobium meliloti GN=dapAL PE=2 SV=1 | 26 | 313 | 5.0E-13 |
sp|Q1CU72|DAPA_HELPH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Helicobacter pylori (strain HPAG1) GN=dapA PE=3 SV=1 | 51 | 264 | 7.0E-13 |
sp|Q2S3M1|DAPA_SALRD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dapA PE=3 SV=1 | 26 | 248 | 8.0E-13 |
sp|Q9ZM13|DAPA_HELPJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dapA PE=3 SV=1 | 51 | 264 | 8.0E-13 |
sp|B3W7E5|DAPA_LACCB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus casei (strain BL23) GN=dapA PE=3 SV=1 | 35 | 309 | 8.0E-13 |
sp|Q03CW3|DAPA_LACC3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus casei (strain ATCC 334) GN=dapA PE=3 SV=1 | 35 | 309 | 8.0E-13 |
sp|A6Q2V4|DAPA_NITSB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=dapA PE=3 SV=1 | 33 | 259 | 1.0E-12 |
sp|A8H415|DAPA_SHEPA | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dapA PE=3 SV=1 | 27 | 242 | 1.0E-12 |
sp|A8GNF1|DAPA_RICAH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia akari (strain Hartford) GN=dapA PE=3 SV=1 | 33 | 263 | 1.0E-12 |
sp|B2USR7|DAPA_HELPS | 4-hydroxy-tetrahydrodipicolinate synthase OS=Helicobacter pylori (strain Shi470) GN=dapA PE=3 SV=1 | 51 | 264 | 1.0E-12 |
sp|A2C5R9|DAPA_PROM3 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=dapA PE=3 SV=1 | 33 | 202 | 1.0E-12 |
sp|Q7V990|DAPA_PROMM | 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=dapA PE=3 SV=1 | 33 | 202 | 1.0E-12 |
sp|Q17WU7|DAPA_HELAH | 4-hydroxy-tetrahydrodipicolinate synthase OS=Helicobacter acinonychis (strain Sheeba) GN=dapA PE=3 SV=1 | 51 | 263 | 1.0E-12 |
sp|A8ET60|DAPA_ARCB4 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Arcobacter butzleri (strain RM4018) GN=dapA PE=3 SV=1 | 33 | 248 | 2.0E-12 |
sp|A7ZDQ5|DAPA_CAMC1 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter concisus (strain 13826) GN=dapA PE=3 SV=1 | 33 | 250 | 2.0E-12 |
sp|F9VPG1|KDGA_SULTO | 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=kdgA PE=1 SV=1 | 30 | 313 | 2.0E-12 |
sp|A8AQB6|NANA_CITK8 | N-acetylneuraminate lyase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nanA PE=3 SV=1 | 33 | 311 | 2.0E-12 |
sp|B5Z6I0|DAPA_HELPG | 4-hydroxy-tetrahydrodipicolinate synthase OS=Helicobacter pylori (strain G27) GN=dapA PE=3 SV=1 | 51 | 264 | 2.0E-12 |
sp|A1BE04|DAPA_CHLPD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dapA PE=3 SV=1 | 26 | 259 | 2.0E-12 |
sp|Q4JC35|KDGA_SULAC | 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0225 PE=1 SV=1 | 30 | 299 | 2.0E-12 |
sp|B6JL09|DAPA_HELP2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Helicobacter pylori (strain P12) GN=dapA PE=3 SV=1 | 33 | 264 | 2.0E-12 |
sp|B1LTD9|DAPA_METRJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dapA PE=3 SV=1 | 40 | 319 | 3.0E-12 |
sp|A9BD97|DAPA_PROM4 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=dapA PE=3 SV=1 | 33 | 324 | 3.0E-12 |
sp|B1MZM8|DAPA_LEUCK | 4-hydroxy-tetrahydrodipicolinate synthase OS=Leuconostoc citreum (strain KM20) GN=dapA PE=3 SV=1 | 33 | 314 | 4.0E-12 |
sp|Q12NF7|DAPA_SHEDO | 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dapA PE=3 SV=1 | 32 | 243 | 6.0E-12 |
sp|A6Q8F8|DAPA_SULNB | 4-hydroxy-tetrahydrodipicolinate synthase OS=Sulfurovum sp. (strain NBC37-1) GN=dapA PE=3 SV=1 | 31 | 241 | 6.0E-12 |
sp|Q6KZI8|KDGA_PICTO | 2-dehydro-3-deoxy-D-gluconate/2-dehydro-3-deoxy-phosphogluconate aldolase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO1279 PE=1 SV=1 | 36 | 263 | 8.0E-12 |
sp|A2BZ39|DAPA_PROM5 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=dapA PE=3 SV=1 | 35 | 222 | 9.0E-12 |
sp|Q3YSK1|DAPA_EHRCJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Ehrlichia canis (strain Jake) GN=dapA PE=3 SV=1 | 26 | 260 | 9.0E-12 |
sp|A0RP26|DAPA_CAMFF | 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=dapA PE=3 SV=1 | 23 | 241 | 1.0E-11 |
sp|B2G6M9|DAPA_LACRJ | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus reuteri (strain JCM 1112) GN=dapA PE=3 SV=1 | 33 | 234 | 1.0E-11 |
sp|A5VJ58|DAPA_LACRD | 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus reuteri (strain DSM 20016) GN=dapA PE=3 SV=1 | 33 | 234 | 1.0E-11 |
sp|B3GZ05|NANA_ACTP7 | N-acetylneuraminate lyase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=nanA PE=3 SV=1 | 58 | 311 | 1.0E-11 |
sp|A3N352|NANA_ACTP2 | N-acetylneuraminate lyase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=nanA PE=3 SV=1 | 58 | 311 | 1.0E-11 |
sp|P59407|NANA_LACPL | N-acetylneuraminate lyase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=nanA PE=1 SV=1 | 58 | 302 | 3.0E-11 |
sp|Q72K27|DAPA_THET2 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dapA PE=3 SV=1 | 41 | 242 | 4.0E-11 |
sp|B0BSI2|NANA_ACTPJ | N-acetylneuraminate lyase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=nanA PE=3 SV=1 | 58 | 311 | 4.0E-11 |
sp|Q5SJQ1|DAPA_THET8 | 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dapA PE=3 SV=1 | 41 | 242 | 4.0E-11 |
sp|B0UTI7|NANA_HISS2 | N-acetylneuraminate lyase OS=Histophilus somni (strain 2336) GN=nanA PE=3 SV=1 | 58 | 319 | 7.0E-11 |
sp|Q0I2T8|NANA_HAES1 | N-acetylneuraminate lyase OS=Haemophilus somnus (strain 129Pt) GN=nanA PE=3 SV=1 | 58 | 319 | 7.0E-11 |
sp|Q92YS6|KDGD_RHIME | Probable 5-dehydro-4-deoxyglucarate dehydratase OS=Rhizobium meliloti (strain 1021) GN=RA0787 PE=3 SV=1 | 32 | 266 | 8.0E-11 |
sp|B5F7J9|NANA_SALA4 | N-acetylneuraminate lyase OS=Salmonella agona (strain SL483) GN=nanA PE=3 SV=1 | 33 | 313 | 1.0E-10 |
sp|P44539|NANA_HAEIN | N-acetylneuraminate lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nanA PE=1 SV=1 | 58 | 317 | 2.0E-10 |
sp|Q7UZK9|DAPA_PROMP | 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dapA PE=3 SV=1 | 35 | 300 | 2.0E-10 |
sp|C0PZN4|NANA_SALPC | N-acetylneuraminate lyase OS=Salmonella paratyphi C (strain RKS4594) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|A9N833|NANA_SALPB | N-acetylneuraminate lyase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|B4T750|NANA_SALNS | N-acetylneuraminate lyase OS=Salmonella newport (strain SL254) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|B4TJR3|NANA_SALHS | N-acetylneuraminate lyase OS=Salmonella heidelberg (strain SL476) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|B5RET7|NANA_SALG2 | N-acetylneuraminate lyase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|B5R0L2|NANA_SALEP | N-acetylneuraminate lyase OS=Salmonella enteritidis PT4 (strain P125109) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|B5FIR8|NANA_SALDC | N-acetylneuraminate lyase OS=Salmonella dublin (strain CT_02021853) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|Q57JC9|NANA_SALCH | N-acetylneuraminate lyase OS=Salmonella choleraesuis (strain SC-B67) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|Q8ZLQ6|NANA_SALTY | N-acetylneuraminate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|B4TWJ0|NANA_SALSV | N-acetylneuraminate lyase OS=Salmonella schwarzengrund (strain CVM19633) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|Q8Z3F0|NANA_SALTI | N-acetylneuraminate lyase OS=Salmonella typhi GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|B5BGP5|NANA_SALPK | N-acetylneuraminate lyase OS=Salmonella paratyphi A (strain AKU_12601) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|Q5PLE9|NANA_SALPA | N-acetylneuraminate lyase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanA PE=3 SV=1 | 33 | 313 | 2.0E-10 |
sp|A4WF38|NANA_ENT38 | N-acetylneuraminate lyase OS=Enterobacter sp. (strain 638) GN=nanA PE=3 SV=1 | 26 | 311 | 2.0E-10 |
sp|A5GHT4|DAPA_SYNPW | 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain WH7803) GN=dapA PE=3 SV=1 | 33 | 195 | 3.0E-10 |
sp|Q30R77|DAPA_SULDN | 4-hydroxy-tetrahydrodipicolinate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=dapA PE=3 SV=1 | 31 | 249 | 5.0E-10 |
GO Term | Description | Terminal node |
---|---|---|
GO:0016829 | lyase activity | Yes |
GO:0003674 | molecular_function | No |
GO:0003824 | catalytic activity | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 13 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauG2|2456 MTKEAPKSKPIRISSTASPCKTLDPGVYVPTVAFFTPHDAIDVETTAKHAKRLAAAGIAGLVTQGSNGEAAHLDR GERQLVTRVTRSALDDCGKSHMPLIVGCGAQSTRETVQLCREAAESGGSHALILPPSYYGSLLTTELIMDHFRTV AQESPLPLVVYNYPAPCGGLDLDSDTILALAEHPNIVGAKLTCGNAGKLARIVAGTVGTGFRTFGGSADSTMQTL AVGGHGVISGLANVAPRACNEVVRLYNAGRSDEAVRLQGVVARGDWAAIKGGFVSVKAALQRYHGYGGLPRKPCS SPRGRALDAQLGEFAELVELEQSIAGTSAAVQQRPPA* |
Coding | >OphauG2|2456 ATGACAAAAGAAGCCCCAAAGTCAAAGCCAATCCGCATCTCGTCGACAGCGTCCCCTTGCAAAACCCTGGACCCT GGAGTATATGTGCCAACTGTTGCCTTCTTCACCCCCCACGACGCAATTGACGTCGAGACAACTGCCAAGCATGCC AAGCGCCTTGCTGCCGCCGGCATTGCAGGCCTTGTCACCCAGGGCTCCAATGGAGAAGCAGCTCACCTGGACCGC GGCGAACGCCAACTGGTGACACGCGTCACACGCTCGGCACTGGACGACTGTGGCAAGTCGCATATGCCCCTTATT GTCGGCTGTGGAGCGCAGTCGACGCGCGAGACGGTGCAGCTTTGTCGCGAAGCAGCCGAGTCGGGGGGCAGCCAC GCCCTGATTTTGCCACCCTCTTACTATGGCTCTCTGCTCACCACGGAGCTCATCATGGATCACTTTCGCACCGTT GCCCAAGAGAGCCCTCTTCCGCTTGTTGTCTACAACTACCCGGCGCCCTGCGGTGGCTTGGATCTCGACTCGGAC ACGATTCTGGCTCTAGCCGAGCACCCCAACATTGTCGGCGCCAAGCTCACATGCGGCAATGCGGGAAAGCTGGCA CGCATTGTGGCTGGAACTGTGGGCACTGGCTTCCGCACCTTTGGCGGCAGCGCAGACTCGACCATGCAGACCTTG GCCGTGGGCGGCCATGGTGTCATTTCAGGCCTTGCCAATGTGGCACCGCGCGCCTGCAACGAGGTGGTGCGCTTG TATAACGCGGGAAGATCCGACGAGGCGGTCCGCTTGCAGGGAGTCGTGGCTCGCGGAGACTGGGCCGCCATCAAG GGCGGCTTCGTGTCCGTCAAGGCTGCTCTTCAGCGTTACCACGGCTATGGAGGCTTGCCGCGCAAGCCCTGCTCT TCGCCGCGGGGTAGGGCTCTCGACGCCCAGCTAGGCGAATTTGCCGAGCTCGTTGAGTTGGAGCAGAGCATTGCG GGCACCTCGGCTGCCGTACAACAGCGGCCACCTGCATGA |
Transcript | >OphauG2|2456 ATGACAAAAGAAGCCCCAAAGTCAAAGCCAATCCGCATCTCGTCGACAGCGTCCCCTTGCAAAACCCTGGACCCT GGAGTATATGTGCCAACTGTTGCCTTCTTCACCCCCCACGACGCAATTGACGTCGAGACAACTGCCAAGCATGCC AAGCGCCTTGCTGCCGCCGGCATTGCAGGCCTTGTCACCCAGGGCTCCAATGGAGAAGCAGCTCACCTGGACCGC GGCGAACGCCAACTGGTGACACGCGTCACACGCTCGGCACTGGACGACTGTGGCAAGTCGCATATGCCCCTTATT GTCGGCTGTGGAGCGCAGTCGACGCGCGAGACGGTGCAGCTTTGTCGCGAAGCAGCCGAGTCGGGGGGCAGCCAC GCCCTGATTTTGCCACCCTCTTACTATGGCTCTCTGCTCACCACGGAGCTCATCATGGATCACTTTCGCACCGTT GCCCAAGAGAGCCCTCTTCCGCTTGTTGTCTACAACTACCCGGCGCCCTGCGGTGGCTTGGATCTCGACTCGGAC ACGATTCTGGCTCTAGCCGAGCACCCCAACATTGTCGGCGCCAAGCTCACATGCGGCAATGCGGGAAAGCTGGCA CGCATTGTGGCTGGAACTGTGGGCACTGGCTTCCGCACCTTTGGCGGCAGCGCAGACTCGACCATGCAGACCTTG GCCGTGGGCGGCCATGGTGTCATTTCAGGCCTTGCCAATGTGGCACCGCGCGCCTGCAACGAGGTGGTGCGCTTG TATAACGCGGGAAGATCCGACGAGGCGGTCCGCTTGCAGGGAGTCGTGGCTCGCGGAGACTGGGCCGCCATCAAG GGCGGCTTCGTGTCCGTCAAGGCTGCTCTTCAGCGTTACCACGGCTATGGAGGCTTGCCGCGCAAGCCCTGCTCT TCGCCGCGGGGTAGGGCTCTCGACGCCCAGCTAGGCGAATTTGCCGAGCTCGTTGAGTTGGAGCAGAGCATTGCG GGCACCTCGGCTGCCGTACAACAGCGGCCACCTGCATGA |
Gene | >OphauG2|2456 ATGACAAAAGAAGCCCCAAAGTCAAAGCCAATCCGCATCTCGTCGACAGCGTCCCCTTGCAAAACCCTGGACCCT GGAGTATATGTGCCAACTGTTGCCTTCTTCACCCCCCACGACGCAATTGACGTCGAGACAACTGCCAAGCATGCC AAGCGCCTTGCTGCCGCCGGCATTGCAGGCCTTGTCACCCAGGGCTCCAATGGAGAAGCAGCTCACCTGGACCGC GGCGAACGCCAACTGGTGACACGCGTCACACGCTCGGCACTGGACGACTGTGGCAAGTCGCATATGCCCCTTATT GTCGGCTGTGGAGCGCAGTCGACGCGCGAGACGGTGCAGCTTTGTCGCGAAGCAGCCGAGTCGGGGGGCAGCCAC GCCCTGATTTTGCCACCCTCTTACTATGGCTCTCTGCTCACCACGGAGCTCATCATGGATCACTTTCGCACCGTT GCCCAAGAGAGCCCTCTTCCGCTTGTTGTCTACAACTACCCGGCGCCCTGCGGTGGCTTGGATCTCGACTCGGAC ACGATTCTGGCTCTAGCCGAGCACCCCAACATTGTCGGCGCCAAGCTCACATGCGGCAATGCGGGAAAGCTGGCA CGCATTGTGGCTGGAACTGTGGGCACTGGCTTCCGCACCTTTGGCGGCAGCGCAGACTCGACCATGCAGACCTTG GCCGTGGGCGGCCATGGTGTCATTTCAGGCCTTGCCAATGTGGCACCGCGCGCCTGCAACGAGGTGGTGCGCTTG TATAACGCGGGAAGATCCGACGAGGCGGTCCGCTTGCAGGGAGTCGTGGCTCGCGGAGACTGGGCCGCCATCAAG GGCGGCTTCGTGTCCGTCAAGGCTGCTCTTCAGCGTTACCACGGCTATGGAGGCTTGCCGCGCAAGCCCTGCTCT TCGCCGCGGGGTAGGGCTCTCGACGCCCAGCTAGGCGAATTTGCCGAGCTCGTTGAGTTGGAGCAGAGCATTGCG GGCACCTCGGCTGCCGTACAACAGCGGCCACCTGCATGA |