Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2432
Gene name
LocationContig_1880:5..680
Strand+
Gene length (bp)675
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14388 DUF4419 Domain of unknown function (DUF4419) 1.3E-46 1 190

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup87
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2106
Ophiocordyceps australis 1348a (Ghana) OphauG2|2432 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|3791
Ophiocordyceps australis 1348a (Ghana) OphauG2|7785
Ophiocordyceps australis map64 (Brazil) OphauB2|538
Ophiocordyceps australis map64 (Brazil) OphauB2|7106
Ophiocordyceps australis map64 (Brazil) OphauB2|8110
Ophiocordyceps camponoti-floridani Ophcf2|04348
Ophiocordyceps camponoti-floridani Ophcf2|06291
Ophiocordyceps camponoti-rufipedis Ophun1|2615
Ophiocordyceps camponoti-rufipedis Ophun1|3024
Ophiocordyceps kimflemingae Ophio5|6311
Ophiocordyceps kimflemingae Ophio5|7302
Ophiocordyceps subramaniannii Hirsu2|3102
Ophiocordyceps subramaniannii Hirsu2|9218

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2432
MQNFFEFLGGSICGIPSVKLQGEKQDWVNLLGKLDHLEEFGEEPTEFARVLRPILQGFVQSWDEPNSPATLEFWS
KIVLSSASHICGTKAEASGWITGFYFWNSDGDIVFTREKRDSMVAGSMLGDVKYIRVQVKLLPVSYAKVPLKLTD
YPGLPGEHHVNLMAGNIGIYRTTNRAKNAVSAEPMSGWYMYGPVDPNRRLSSNSGNKDELASITTSFEECPASY*
Coding >OphauG2|2432
ATGCAAAACTTTTTCGAGTTCCTGGGCGGGTCCATCTGCGGGATCCCGTCGGTCAAGCTCCAGGGCGAAAAGCAG
GACTGGGTCAACCTGCTGGGCAAGCTCGACCACCTCGAGGAATTCGGCGAGGAGCCGACCGAGTTTGCGCGCGTG
CTGCGGCCCATTCTCCAGGGCTTTGTGCAATCATGGGACGAGCCCAACTCTCCAGCGACGCTTGAATTCTGGTCC
AAGATTGTCCTCAGCTCAGCCTCGCATATTTGCGGCACCAAGGCCGAGGCCTCTGGCTGGATCACCGGCTTCTAC
TTCTGGAACAGCGACGGCGACATTGTGTTTACGCGCGAGAAGCGGGACTCCATGGTTGCAGGCTCCATGCTGGGC
GACGTCAAGTACATTCGCGTCCAGGTCAAGCTTCTGCCCGTCAGCTACGCCAAGGTGCCGCTCAAGCTGACAGAC
TACCCCGGCCTGCCGGGCGAGCACCACGTCAACCTGATGGCGGGCAACATTGGCATCTATCGCACCACGAACCGC
GCCAAGAATGCAGTGAGTGCTGAGCCCATGAGCGGCTGGTACATGTATGGCCCGGTGGACCCCAACAGGCGCCTG
AGTTCAAACTCGGGGAACAAGGACGAGCTTGCCTCTATTACGACGAGTTTTGAGGAGTGTCCGGCCAGCTATTAG
Transcript >OphauG2|2432
ATGCAAAACTTTTTCGAGTTCCTGGGCGGGTCCATCTGCGGGATCCCGTCGGTCAAGCTCCAGGGCGAAAAGCAG
GACTGGGTCAACCTGCTGGGCAAGCTCGACCACCTCGAGGAATTCGGCGAGGAGCCGACCGAGTTTGCGCGCGTG
CTGCGGCCCATTCTCCAGGGCTTTGTGCAATCATGGGACGAGCCCAACTCTCCAGCGACGCTTGAATTCTGGTCC
AAGATTGTCCTCAGCTCAGCCTCGCATATTTGCGGCACCAAGGCCGAGGCCTCTGGCTGGATCACCGGCTTCTAC
TTCTGGAACAGCGACGGCGACATTGTGTTTACGCGCGAGAAGCGGGACTCCATGGTTGCAGGCTCCATGCTGGGC
GACGTCAAGTACATTCGCGTCCAGGTCAAGCTTCTGCCCGTCAGCTACGCCAAGGTGCCGCTCAAGCTGACAGAC
TACCCCGGCCTGCCGGGCGAGCACCACGTCAACCTGATGGCGGGCAACATTGGCATCTATCGCACCACGAACCGC
GCCAAGAATGCAGTGAGTGCTGAGCCCATGAGCGGCTGGTACATGTATGGCCCGGTGGACCCCAACAGGCGCCTG
AGTTCAAACTCGGGGAACAAGGACGAGCTTGCCTCTATTACGACGAGTTTTGAGGAGTGTCCGGCCAGCTATTAG
Gene >OphauG2|2432
ATGCAAAACTTTTTCGAGTTCCTGGGCGGGTCCATCTGCGGGATCCCGTCGGTCAAGCTCCAGGGCGAAAAGCAG
GACTGGGTCAACCTGCTGGGCAAGCTCGACCACCTCGAGGAATTCGGCGAGGAGCCGACCGAGTTTGCGCGCGTG
CTGCGGCCCATTCTCCAGGGCTTTGTGCAATCATGGGACGAGCCCAACTCTCCAGCGACGCTTGAATTCTGGTCC
AAGATTGTCCTCAGCTCAGCCTCGCATATTTGCGGCACCAAGGCCGAGGCCTCTGGCTGGATCACCGGCTTCTAC
TTCTGGAACAGCGACGGCGACATTGTGTTTACGCGCGAGAAGCGGGACTCCATGGTTGCAGGCTCCATGCTGGGC
GACGTCAAGTACATTCGCGTCCAGGTCAAGCTTCTGCCCGTCAGCTACGCCAAGGTGCCGCTCAAGCTGACAGAC
TACCCCGGCCTGCCGGGCGAGCACCACGTCAACCTGATGGCGGGCAACATTGGCATCTATCGCACCACGAACCGC
GCCAAGAATGCAGTGAGTGCTGAGCCCATGAGCGGCTGGTACATGTATGGCCCGGTGGACCCCAACAGGCGCCTG
AGTTCAAACTCGGGGAACAAGGACGAGCTTGCCTCTATTACGACGAGTTTTGAGGAGTGTCCGGCCAGCTATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail