Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2428
Gene name
LocationContig_188:15493..17228
Strand+
Gene length (bp)1735
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01485 IBR IBR domain, a half RING-finger domain 3.8E-13 211 278
PF01485 IBR IBR domain, a half RING-finger domain 2.1E-08 296 342
PF19422 Ariadne Ariadne domain 3.0E-14 363 482
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 4.0E-05 142 188

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3U4|HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbl4 PE=3 SV=1 26 517 0.0E+00
sp|Q94981|ARI1_DROME Protein ariadne-1 OS=Drosophila melanogaster GN=ari-1 PE=1 SV=2 44 515 3.0E-129
sp|Q9Z1K5|ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus GN=Arih1 PE=1 SV=3 63 517 3.0E-122
sp|B1H1E4|ARI1_XENTR E3 ubiquitin-protein ligase arih1 OS=Xenopus tropicalis GN=arih1 PE=2 SV=1 63 517 3.0E-122
sp|Q9Y4X5|ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens GN=ARIH1 PE=1 SV=2 63 517 3.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3U4|HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbl4 PE=3 SV=1 26 517 0.0E+00
sp|Q94981|ARI1_DROME Protein ariadne-1 OS=Drosophila melanogaster GN=ari-1 PE=1 SV=2 44 515 3.0E-129
sp|Q9Z1K5|ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus GN=Arih1 PE=1 SV=3 63 517 3.0E-122
sp|B1H1E4|ARI1_XENTR E3 ubiquitin-protein ligase arih1 OS=Xenopus tropicalis GN=arih1 PE=2 SV=1 63 517 3.0E-122
sp|Q9Y4X5|ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens GN=ARIH1 PE=1 SV=2 63 517 3.0E-122
sp|A2VEA3|ARI1_BOVIN E3 ubiquitin-protein ligase ARIH1 OS=Bos taurus GN=ARIH1 PE=2 SV=1 63 517 3.0E-122
sp|Q6PFJ9|ARI1_DANRE E3 ubiquitin-protein ligase arih1 OS=Danio rerio GN=arih1 PE=2 SV=1 63 517 5.0E-122
sp|Q32NS4|ARI1_XENLA E3 ubiquitin-protein ligase arih1 OS=Xenopus laevis GN=arih1 PE=2 SV=1 63 517 1.0E-121
sp|Q6NW85|ARI1L_DANRE E3 ubiquitin-protein ligase arih1l OS=Danio rerio GN=arih1l PE=2 SV=1 63 517 2.0E-121
sp|Q6T486|RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum GN=rbrA PE=3 SV=1 13 510 3.0E-96
sp|Q9Z1K6|ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus GN=Arih2 PE=1 SV=1 18 505 6.0E-88
sp|O76924|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1 70 502 1.0E-87
sp|O95376|ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens GN=ARIH2 PE=1 SV=1 18 505 1.0E-87
sp|P36113|HEL1_YEAST E3 ubiquitin-protein ligase HEL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEL1 PE=1 SV=1 79 510 5.0E-86
sp|Q8L829|ARI5_ARATH Probable E3 ubiquitin-protein ligase ARI5 OS=Arabidopsis thaliana GN=ARI5 PE=2 SV=1 32 474 4.0E-80
sp|Q84RR0|ARI7_ARATH Probable E3 ubiquitin-protein ligase ARI7 OS=Arabidopsis thaliana GN=ARI7 PE=2 SV=1 1 476 2.0E-77
sp|Q9LVX0|ARI3_ARATH Probable E3 ubiquitin-protein ligase ARI3 OS=Arabidopsis thaliana GN=ARI3 PE=2 SV=1 33 509 5.0E-76
sp|Q22431|ARI2_CAEEL Probable protein ariadne-2 OS=Caenorhabditis elegans GN=T12E12.1 PE=3 SV=2 71 471 2.0E-75
sp|P0C8K8|ARI6_ARATH Putative E3 ubiquitin-protein ligase ARI6 OS=Arabidopsis thaliana GN=ARI6 PE=5 SV=1 61 474 3.0E-75
sp|Q8W468|ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana GN=ARI8 PE=2 SV=1 11 480 2.0E-74
sp|Q9LVW9|ARI4_ARATH Putative E3 ubiquitin-protein ligase ARI4 OS=Arabidopsis thaliana GN=ARI4 PE=5 SV=2 31 509 5.0E-74
sp|Q9SKC4|ARI10_ARATH Probable E3 ubiquitin-protein ligase ARI10 OS=Arabidopsis thaliana GN=ARI10 PE=2 SV=1 13 476 3.0E-72
sp|Q9SKC3|ARI9_ARATH Probable E3 ubiquitin-protein ligase ARI9 OS=Arabidopsis thaliana GN=ARI9 PE=2 SV=1 13 476 3.0E-70
sp|Q84RR2|ARI2_ARATH Probable E3 ubiquitin-protein ligase ARI2 OS=Arabidopsis thaliana GN=ARI2 PE=2 SV=1 45 481 1.0E-67
sp|Q9SKC2|ARI11_ARATH Probable E3 ubiquitin-protein ligase ARI11 OS=Arabidopsis thaliana GN=ARI11 PE=2 SV=1 70 442 3.0E-67
sp|Q949V6|ARI1_ARATH Probable E3 ubiquitin-protein ligase ARI1 OS=Arabidopsis thaliana GN=ARI1 PE=2 SV=1 74 521 1.0E-65
sp|Q9P2G1|AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens GN=ANKIB1 PE=1 SV=3 68 510 3.0E-64
sp|Q6ZPS6|AKIB1_MOUSE Ankyrin repeat and IBR domain-containing protein 1 OS=Mus musculus GN=Ankib1 PE=1 SV=2 68 483 2.0E-63
sp|Q1L8G6|AKIB1_DANRE Ankyrin repeat and IBR domain-containing protein 1 OS=Danio rerio GN=ankib1 PE=3 SV=1 70 508 3.0E-60
sp|Q8IWT3|CUL9_HUMAN Cullin-9 OS=Homo sapiens GN=CUL9 PE=1 SV=2 48 473 4.0E-37
sp|Q80TT8|CUL9_MOUSE Cullin-9 OS=Mus musculus GN=Cul9 PE=1 SV=2 68 478 5.0E-36
sp|Q9C5A4|ARI16_ARATH Probable E3 ubiquitin-protein ligase ARI16 OS=Arabidopsis thaliana GN=ARI16 PE=2 SV=1 79 497 6.0E-34
sp|Q84RQ9|ARI12_ARATH Probable E3 ubiquitin-protein ligase ARI12 OS=Arabidopsis thaliana GN=ARI12 PE=2 SV=2 70 474 1.0E-27
sp|Q54CX4|Y5521_DICDI Uncharacterized protein DDB_G0292642 OS=Dictyostelium discoideum GN=DDB_G0292642 PE=3 SV=2 142 353 2.0E-25
sp|Q9FFN9|ARI13_ARATH Probable E3 ubiquitin-protein ligase ARI13 OS=Arabidopsis thaliana GN=ARI13 PE=2 SV=1 51 477 4.0E-25
sp|Q9JI90|RNF14_MOUSE E3 ubiquitin-protein ligase RNF14 OS=Mus musculus GN=Rnf14 PE=1 SV=2 140 336 3.0E-23
sp|Q9UBS8|RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens GN=RNF14 PE=1 SV=1 140 339 8.0E-23
sp|Q9FFP1|ARI14_ARATH Probable E3 ubiquitin-protein ligase ARI14 OS=Arabidopsis thaliana GN=ARI14 PE=2 SV=1 55 441 1.0E-21
sp|Q84RQ8|ARI15_ARATH Probable E3 ubiquitin-protein ligase ARI15 OS=Arabidopsis thaliana GN=ARI15 PE=2 SV=1 116 480 2.0E-19
sp|Q2VJ60|RN19A_PIG E3 ubiquitin-protein ligase RNF19A OS=Sus scrofa GN=RNF19A PE=2 SV=1 157 335 1.0E-17
sp|Q9NV58|RN19A_HUMAN E3 ubiquitin-protein ligase RNF19A OS=Homo sapiens GN=RNF19A PE=1 SV=3 157 335 1.0E-17
sp|P50636|RN19A_MOUSE E3 ubiquitin-protein ligase RNF19A OS=Mus musculus GN=Rnf19a PE=1 SV=2 157 335 2.0E-17
sp|A2A7Q9|RN19B_MOUSE E3 ubiquitin-protein ligase RNF19B OS=Mus musculus GN=Rnf19b PE=1 SV=2 157 335 7.0E-17
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 142 340 8.0E-17
sp|Q6ZMZ0|RN19B_HUMAN E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens GN=RNF19B PE=1 SV=2 157 335 9.0E-17
sp|Q1L8L6|RN19B_DANRE E3 ubiquitin-protein ligase RNF19B OS=Danio rerio GN=rnf19b PE=3 SV=2 159 335 5.0E-16
sp|Q9US46|ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itt1 PE=3 SV=1 137 342 9.0E-16
sp|A5PK27|R144B_BOVIN E3 ubiquitin-protein ligase RNF144B OS=Bos taurus GN=RNF144B PE=2 SV=1 134 335 1.0E-14
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 142 340 3.0E-14
sp|Q08B84|RN19B_XENLA E3 ubiquitin-protein ligase RNF19B OS=Xenopus laevis GN=rnf19b PE=2 SV=2 157 335 3.0E-14
sp|Q5RFV4|R1441_DANRE Probable E3 ubiquitin-protein ligase RNF144A-A OS=Danio rerio GN=rnf144aa PE=3 SV=1 158 335 8.0E-14
sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 134 335 1.0E-13
sp|Q6DH94|R1442_DANRE Probable E3 ubiquitin-protein ligase RNF144A-B OS=Danio rerio GN=rnf144ab PE=2 SV=1 158 335 2.0E-13
sp|Q8BKD6|R144B_MOUSE E3 ubiquitin-protein ligase RNF144B OS=Mus musculus GN=Rnf144b PE=2 SV=2 132 335 2.0E-13
sp|P50876|R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens GN=RNF144A PE=1 SV=2 158 335 3.0E-12
sp|Q925F3|R144A_MOUSE E3 ubiquitin-protein ligase RNF144A OS=Mus musculus GN=Rnf144a PE=1 SV=1 158 335 4.0E-12
sp|A4IIY1|R144A_XENTR Probable E3 ubiquitin-protein ligase RNF144A OS=Xenopus tropicalis GN=rnf144a PE=2 SV=1 134 335 3.0E-11
sp|Q4KLT0|RN217_XENLA Probable E3 ubiquitin-protein ligase RNF217 OS=Xenopus laevis GN=rnf217 PE=2 SV=1 142 334 9.0E-09
sp|Q924T7|RNF31_MOUSE E3 ubiquitin-protein ligase RNF31 OS=Mus musculus GN=Rnf31 PE=1 SV=2 157 334 1.0E-08
sp|Q9WVS6|PRKN2_MOUSE E3 ubiquitin-protein ligase parkin OS=Mus musculus GN=Park2 PE=1 SV=1 150 346 1.0E-08
sp|Q96EP0|RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens GN=RNF31 PE=1 SV=1 164 334 2.0E-08
sp|Q8TC41|RN217_HUMAN Probable E3 ubiquitin-protein ligase RNF217 OS=Homo sapiens GN=RNF217 PE=2 SV=4 122 334 3.0E-08
sp|Q9JK66|PRKN2_RAT E3 ubiquitin-protein ligase parkin OS=Rattus norvegicus GN=Park2 PE=1 SV=1 142 346 7.0E-08
sp|D3YYI7|RN217_MOUSE Probable E3 ubiquitin-protein ligase RNF217 OS=Mus musculus GN=Rnf217 PE=3 SV=2 122 334 7.0E-08
sp|O60260|PRKN2_HUMAN E3 ubiquitin-protein ligase parkin OS=Homo sapiens GN=PARK2 PE=1 SV=2 142 346 5.0E-07
sp|Q5UQ35|YR811_MIMIV Putative ariadne-like RING finger protein R811 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R811 PE=3 SV=1 286 361 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4549
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2428 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3682
Ophiocordyceps camponoti-floridani Ophcf2|05259
Ophiocordyceps camponoti-rufipedis Ophun1|6260
Ophiocordyceps kimflemingae Ophio5|1972
Ophiocordyceps subramaniannii Hirsu2|9512

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2428
MDSEDEYISNMSTDDDMVQDYSGDGISEAEEFDDDDFDEPDPDFGLSSKEMTSTKRPLHAITFKIHIPADIERQQ
DDMVGEVNMILDMRKEDAAILLRYFRWNKERLLEDYMDHPDKVLEAAGLGPHSSTLPKLQVIPGFLCDICYQDGN
DVESFAIKCGHRYCSDCYRQYLTQKIRDQGEAARIQCPAQGCGRIIDSRSLNLLVTGDLRDRYHQLLNRSYVEDK
DNFKWCPAPDCPNAVECGVRRKDLDKIVPTVECQCGYRFCFGCPNADHQPAPCELVKKWLKKCADDSETANWISA
NTKECPKCSSTIEKNGGCNHMTCRKCKHEFCWMCMGLWSEHGTSWYSCNRYEEKSGAEARDAQARSRTSLERYLH
YYNRYANHEQSAKLDKDIAQKTEKKMVQLQTTSGMSWIEVQYLNSASQALQTCRQTLKWTYAFAYYLAKNNLTEI
FEDNQKDLEMAVENLSEMFEKPIQELSDPKLKVDIMDKTSYCNKRRIILLDDTADNLAKGKWTFSTDFIGSSTSR
R*
Coding >OphauG2|2428
ATGGATTCCGAAGACGAGTATATTAGCAACATGTCTACCGACGATGACATGGTCCAGGACTATAGCGGCGATGGC
ATTTCCGAAGCAGAAGAATTTGACGATGATGATTTTGACGAGCCCGATCCCGACTTTGGCCTGTCATCTAAAGAA
ATGACAAGCACCAAACGTCCGCTACATGCAATCACCTTCAAAATTCACATACCTGCCGACATCGAGCGCCAGCAA
GACGACATGGTTGGCGAAGTCAACATGATTCTCGATATGCGCAAGGAGGACGCGGCTATTCTGCTGCGATACTTT
CGATGGAACAAGGAGCGCCTACTCGAAGACTACATGGACCATCCCGACAAGGTTCTCGAGGCGGCCGGTCTCGGT
CCCCACTCGTCAACCCTTCCCAAGCTGCAAGTCATTCCAGGATTTCTATGTGACATTTGCTACCAAGATGGCAAC
GACGTGGAATCTTTTGCCATCAAGTGTGGCCATAGATACTGCTCCGACTGCTATAGACAGTATCTGACACAGAAA
ATCAGAGACCAAGGCGAGGCGGCACGAATTCAGTGTCCAGCCCAAGGCTGCGGCCGCATCATTGACTCGCGTTCT
CTCAATCTCCTGGTGACTGGTGACCTCCGCGACCGCTACCACCAATTGCTCAACCGCTCATACGTTGAAGACAAG
GACAACTTCAAATGGTGTCCTGCTCCAGATTGCCCCAACGCCGTAGAGTGCGGGGTGAGAAGGAAGGATCTCGAC
AAAATTGTGCCCACGGTTGAGTGCCAGTGCGGCTACCGCTTCTGCTTCGGATGCCCAAATGCCGACCATCAACCA
GCTCCCTGCGAACTGGTTAAAAAATGGCTTAAGAAATGCGCAGACGACTCCGAGACGGCAAATTGGATATCGGCC
AATACAAAGGAGTGTCCCAAATGCAGTTCCACGATTGAGAAGAATGGCGGGTGCAATCACATGACGTGCCGCAAG
TGCAAACACGAGTTTTGCTGGATGTGCATGGGGCTTTGGTCGGAACATGGAACCAGCTGGTATAGCTGCAACAGG
TATGAAGAAAAGAGCGGTGCAGAGGCTCGTGATGCACAGGCGCGCTCGCGTACATCTCTGGAGCGCTACCTGCAT
TACTACAACCGTTATGCCAACCACGAGCAGTCGGCCAAGCTGGACAAGGACATTGCTCAAAAGACGGAGAAGAAG
ATGGTACAGCTGCAAACGACGAGCGGCATGTCGTGGATCGAGGTGCAGTATCTCAACTCGGCCTCGCAGGCTCTG
CAGACGTGCCGCCAGACTCTCAAATGGACCTATGCCTTTGCCTACTACCTGGCCAAGAACAACTTGACCGAGATA
TTTGAAGACAACCAAAAGGATCTCGAAATGGCGGTGGAAAACCTTTCCGAAATGTTTGAGAAGCCCATTCAGGAG
CTGTCGGACCCCAAGCTCAAGGTGGACATTATGGACAAGACGTCGTACTGCAATAAGCGCCGCATCATTTTGTTG
GACGACACTGCTGACAACTTGGCCAAGGGAAAATGGACTTTTAGCACTGATTTCATTGGCTCCTCCACCTCACGT
CGCTAA
Transcript >OphauG2|2428
ATGGATTCCGAAGACGAGTATATTAGCAACATGTCTACCGACGATGACATGGTCCAGGACTATAGCGGCGATGGC
ATTTCCGAAGCAGAAGAATTTGACGATGATGATTTTGACGAGCCCGATCCCGACTTTGGCCTGTCATCTAAAGAA
ATGACAAGCACCAAACGTCCGCTACATGCAATCACCTTCAAAATTCACATACCTGCCGACATCGAGCGCCAGCAA
GACGACATGGTTGGCGAAGTCAACATGATTCTCGATATGCGCAAGGAGGACGCGGCTATTCTGCTGCGATACTTT
CGATGGAACAAGGAGCGCCTACTCGAAGACTACATGGACCATCCCGACAAGGTTCTCGAGGCGGCCGGTCTCGGT
CCCCACTCGTCAACCCTTCCCAAGCTGCAAGTCATTCCAGGATTTCTATGTGACATTTGCTACCAAGATGGCAAC
GACGTGGAATCTTTTGCCATCAAGTGTGGCCATAGATACTGCTCCGACTGCTATAGACAGTATCTGACACAGAAA
ATCAGAGACCAAGGCGAGGCGGCACGAATTCAGTGTCCAGCCCAAGGCTGCGGCCGCATCATTGACTCGCGTTCT
CTCAATCTCCTGGTGACTGGTGACCTCCGCGACCGCTACCACCAATTGCTCAACCGCTCATACGTTGAAGACAAG
GACAACTTCAAATGGTGTCCTGCTCCAGATTGCCCCAACGCCGTAGAGTGCGGGGTGAGAAGGAAGGATCTCGAC
AAAATTGTGCCCACGGTTGAGTGCCAGTGCGGCTACCGCTTCTGCTTCGGATGCCCAAATGCCGACCATCAACCA
GCTCCCTGCGAACTGGTTAAAAAATGGCTTAAGAAATGCGCAGACGACTCCGAGACGGCAAATTGGATATCGGCC
AATACAAAGGAGTGTCCCAAATGCAGTTCCACGATTGAGAAGAATGGCGGGTGCAATCACATGACGTGCCGCAAG
TGCAAACACGAGTTTTGCTGGATGTGCATGGGGCTTTGGTCGGAACATGGAACCAGCTGGTATAGCTGCAACAGG
TATGAAGAAAAGAGCGGTGCAGAGGCTCGTGATGCACAGGCGCGCTCGCGTACATCTCTGGAGCGCTACCTGCAT
TACTACAACCGTTATGCCAACCACGAGCAGTCGGCCAAGCTGGACAAGGACATTGCTCAAAAGACGGAGAAGAAG
ATGGTACAGCTGCAAACGACGAGCGGCATGTCGTGGATCGAGGTGCAGTATCTCAACTCGGCCTCGCAGGCTCTG
CAGACGTGCCGCCAGACTCTCAAATGGACCTATGCCTTTGCCTACTACCTGGCCAAGAACAACTTGACCGAGATA
TTTGAAGACAACCAAAAGGATCTCGAAATGGCGGTGGAAAACCTTTCCGAAATGTTTGAGAAGCCCATTCAGGAG
CTGTCGGACCCCAAGCTCAAGGTGGACATTATGGACAAGACGTCGTACTGCAATAAGCGCCGCATCATTTTGTTG
GACGACACTGCTGACAACTTGGCCAAGGGAAAATGGACTTTTAGCACTGATTTCATTGGCTCCTCCACCTCACGT
CGCTAA
Gene >OphauG2|2428
ATGGATTCCGAAGACGAGTATATTAGCAACATGTCTACCGACGATGACATGGTCCAGGACTATAGCGGCGATGGC
ATTTCCGAAGCAGAAGGCGAGTCCCATTCTGCCCCTCGTGTCCACCCAGCCCATGCTGACCTTGGCTGCAGAATT
TGACGATGATGATTTTGACGAGCCCGATCCCGACTTTGGCCTGTCATCTAAAGAAATGACAAGCACCAAACGTCC
GCTACATGCAATCACCTTCAAAATTCACATACCTGCCGACATCGAGCGCCAGCAAGACGACATGGTTGGCGAAGT
CAACATGATTCTCGATATGCGCAAGGAGGACGCGGCTATTCTGCTGCGATACTTTCGATGGAACAAGGAGCGCCT
ACTCGAAGACTACATGGACCATCCCGACAAGGTTCTCGAGGCGGCCGGTCTCGGTCCCCACTCGTCAACCCTTCC
CAAGCTGCAAGTCATTCCAGGATTTCTATGTGACATTTGCTACCAAGATGGCAACGACGTGGAATCTTTTGCCAT
CAAGTGTGGCCATAGATACTGCTCCGACTGCTATAGACAGTATCTGACACAGAAAATCAGAGACCAAGGCGAGGC
GGCACGAATTCAGTGTCCAGCCCAAGGCTGCGGCCGCATCATTGACTCGCGTTCTCTCAATCTCCTGGTGACTGG
TGACCTCCGCGACCGCTACCACCAATTGCTCAACCGCTCATACGTTGAAGACAAGGACAACTTCAAATGGTGTCC
TGCTCCAGATTGCCCCAACGCCGTAGAGTGCGGGGTGAGAAGGAAGGATCTCGACAAAATTGTGCCCACGGTTGA
GTGCCAGTGCGGCTACCGCTTCTGCTTCGGATGCCCAAATGCCGACCATCAACCAGCTCCCTGCGAACTGGTTAA
AAAATGGCTTAAGAAATGCGCAGACGACTCCGAGACGGCAAATTGGATATCGGCCAATACAAAGGAGTGTCCCAA
ATGCAGTTCCACGATTGAGAAGAATGGCGGGTGCAATCACATGACGTGCCGCAAGTGCAAACACGAGTTTTGCTG
GATGTGCATGGGGCTTTGGTCGGAACATGGAACCAGCTGGTATAGCTGCAACAGGTATGAAGAAAAGAGCGGTGC
AGAGGCTCGTGATGCACAGGCGCGCTCGCGTACATCTCTGGAGCGCTACCTGCATTACTACAACCGTTATGCCAA
CCACGAGCAGTCGGCCAAGCTGGACAAGGACATTGCTCAAAAGACGGAGAAGAAGATGGTACAGCTGCAAACGAC
GAGCGGCATGTCGTGGATCGAGGTGCAGTATCTCAACTCGGCCTCGCAGGCTCTGCAGACGTGCCGCCAGACTCT
CAAATGGACCTATGCCTTTGCCTACTACCTGGCCAAGAACAACTTGACCGAGATATTTGAAGACAACCAAAAGGA
TCTCGAAATGGCGGTGGAAAACCTTTCCGAAATGTTTGAGAAGCCCATTCAGGAGCTGTCGGACCCCAAGCTCAA
GGTGGACATTATGGACAAGACGTCGTACTGCAATAAGCGCCGCATCATTTTGTTGGACGACACTGCTGACAACTT
GGCCAAGGGTATGCAACATTGCCTTTTGTCTGTTCTTTCTTGTCTTTTGACCCTTGTCCTGGCCGAGAGAATAAG
CCTTTACGCTGACCACAGAAGCAACACAATAGGAAAATGGACTTTTAGCACTGATTTCATTGGCTCCTCCACCTC
ACGTCGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail