Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2424
Gene name
LocationContig_188:5449..6247
Strand+
Gene length (bp)798
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999707

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5230
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2424 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|5061
Ophiocordyceps australis map64 (Brazil) OphauB2|3686
Ophiocordyceps subramaniannii Hirsu2|4281
Ophiocordyceps subramaniannii Hirsu2|8631

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2424
MRLIPMAFSLAVLVAEISAAEEPISETELSKMISQLNLATETIDLNDPPYKHGEAFGEPTCFANWFYCSQTVFFN
REVMSGGPYSTNVTPIFSQDALLFNDNDEPSKIGSTQSTAKLEASTKGWQISARIGVSQDRFTADINAQYKDETI
KSTTMTKTVEYSSTCPPHKTCRIQTVTFKAQLVGFCADDPYLLCTNSPDFGPEHEISICTVDDTWVTSCSQYREY
ARKTEELCKNRKDPRKYCEVEVPLLDDKGEPLRAVVITHG*
Coding >OphauG2|2424
ATGCGTTTGATACCAATGGCTTTTAGCCTTGCAGTTCTTGTTGCCGAGATCAGTGCTGCCGAGGAACCAATATCT
GAAACAGAGCTGTCTAAAATGATTTCACAACTCAACCTTGCTACGGAAACCATCGACCTTAACGACCCACCTTAC
AAACATGGAGAGGCTTTTGGAGAACCGACTTGCTTTGCCAATTGGTTCTATTGCAGTCAGACCGTCTTCTTCAAT
CGTGAAGTCATGAGCGGTGGCCCTTACTCAACAAACGTGACGCCTATATTCTCACAAGACGCTCTTTTATTCAAC
GATAATGACGAGCCGTCGAAAATCGGGTCAACGCAGTCAACTGCAAAGCTCGAGGCGTCAACCAAGGGCTGGCAA
ATCTCGGCGAGAATTGGCGTCTCCCAGGACAGATTCACTGCCGATATCAATGCCCAGTACAAGGACGAAACGATC
AAATCCACTACTATGACGAAGACGGTCGAGTATTCGTCGACTTGCCCGCCTCACAAGACGTGCCGCATCCAGACT
GTGACTTTCAAGGCGCAGCTGGTGGGCTTTTGCGCCGACGACCCTTACCTGCTCTGCACGAATAGCCCGGATTTT
GGACCTGAACATGAGATTAGCATTTGCACTGTGGACGATACATGGGTCACCTCGTGCAGCCAGTATCGGGAGTAT
GCGCGCAAGACTGAGGAGCTCTGCAAAAACCGCAAAGACCCCAGAAAATATTGCGAGGTGGAAGTTCCGCTGCTG
GACGACAAGGGCGAGCCTTTGCGCGCCGTTGTCATTACGCATGGGTAA
Transcript >OphauG2|2424
ATGCGTTTGATACCAATGGCTTTTAGCCTTGCAGTTCTTGTTGCCGAGATCAGTGCTGCCGAGGAACCAATATCT
GAAACAGAGCTGTCTAAAATGATTTCACAACTCAACCTTGCTACGGAAACCATCGACCTTAACGACCCACCTTAC
AAACATGGAGAGGCTTTTGGAGAACCGACTTGCTTTGCCAATTGGTTCTATTGCAGTCAGACCGTCTTCTTCAAT
CGTGAAGTCATGAGCGGTGGCCCTTACTCAACAAACGTGACGCCTATATTCTCACAAGACGCTCTTTTATTCAAC
GATAATGACGAGCCGTCGAAAATCGGGTCAACGCAGTCAACTGCAAAGCTCGAGGCGTCAACCAAGGGCTGGCAA
ATCTCGGCGAGAATTGGCGTCTCCCAGGACAGATTCACTGCCGATATCAATGCCCAGTACAAGGACGAAACGATC
AAATCCACTACTATGACGAAGACGGTCGAGTATTCGTCGACTTGCCCGCCTCACAAGACGTGCCGCATCCAGACT
GTGACTTTCAAGGCGCAGCTGGTGGGCTTTTGCGCCGACGACCCTTACCTGCTCTGCACGAATAGCCCGGATTTT
GGACCTGAACATGAGATTAGCATTTGCACTGTGGACGATACATGGGTCACCTCGTGCAGCCAGTATCGGGAGTAT
GCGCGCAAGACTGAGGAGCTCTGCAAAAACCGCAAAGACCCCAGAAAATATTGCGAGGTGGAAGTTCCGCTGCTG
GACGACAAGGGCGAGCCTTTGCGCGCCGTTGTCATTACGCATGGGTAA
Gene >OphauG2|2424
ATGCGTTTGATACCAATGGCTTTTAGCCTTGCAGTTCTTGTTGCCGAGATCAGTGCTGCCGAGGAACCAATATCT
GAAACAGAGCTGTCTAAAATGATTTCACAACTCAACCTTGCTACGGAAACCATCGACCTTAACGACCCACCTTAC
AAACATGGAGAGGCTTTTGGAGAACCGACTTGCTTTGCCAATTGGTTCTATTGCAGTCAGACCGTCTTCTTCAAT
CGTGAAGTCATGAGCGGTGGCCCTTACTCAACAAACGTGACGCCTATATTCTCACAAGACGCTCTTTTATTCAAC
GATAATGACGAGCCGTCGAAAATCGGGTCAACGCAGTCAACTGCAAAGCTCGAGGCGTCAACCAAGGGCTGGCAA
ATCTCGGCGAGAATTGGCGTCTCCCAGGACAGATTCACTGCCGATATCAATGCCCAGTACAAGGACGAAACGATC
AAATCCACTACTATGACGAAGACGGTCGAGTATTCGTCGACTTGCCCGCCTCACAAGACGTGCCGCATCCAGACT
GTGACTTTCAAGGCGCAGCTGGTGGGCTTTTGCGCCGACGACCCTTACCTGCTCTGCACGAATAGCCCGGATTTT
GGACCTGAACATGAGATTAGCATTTGCACTGTGGACGATACATGGGTCACCTCGTGCAGCCAGTATCGGGAGTAT
GCGCGCAAGACTGAGGAGCTCTGCAAAAACCGCAAAGACCCCAGAAAATATTGCGAGGTGGAAGTTCCGCTGCTG
GACGACAAGGGCGAGCCTTTGCGCGCCGTTGTCATTACGCATGGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail