Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2421
Gene name
LocationContig_1877:2..741
Strand+
Gene length (bp)739
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup714
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2421 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|882
Ophiocordyceps australis map64 (Brazil) OphauB2|3723
Ophiocordyceps camponoti-floridani Ophcf2|03033
Ophiocordyceps camponoti-rufipedis Ophun1|7238
Ophiocordyceps kimflemingae Ophio5|823
Ophiocordyceps subramaniannii Hirsu2|158

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2421
MQLFQVGPSGPSSPATYTQSLLYQVVKHHIDALQTLELTCKTALFGLDALERHATTLQVLRLQDHVGFQDDSRTC
PTLGHDSVRELASALVHVHTLELDMDTAEATEFLEAVCLFPRLHTLTLHVQTRVRPDDEAEVHSDADDEAAAEML
GLLLRRRKGGVAWRRVTINVGGWRRAMVRRVGYEWKKQNQRGVFAERCFVMEAHEEGGYAVRDEACQKGSLRRRL
ADQA*
Coding >OphauG2|2421
ATGCAACTTTTTCAAGTCGGTCCATCTGGACCATCTTCGCCGGCTACATACACTCAAAGCCTGCTATACCAAGTC
GTCAAACACCACATTGATGCCCTGCAGACTCTCGAGTTGACGTGCAAGACGGCATTGTTTGGACTCGACGCGCTA
GAGCGGCACGCCACGACGTTGCAGGTGCTTCGTTTGCAGGACCACGTGGGCTTCCAAGACGACAGCAGGACGTGT
CCGACGCTGGGCCACGACTCGGTGCGCGAGCTGGCGTCTGCTCTAGTTCACGTGCACACGCTTGAGCTGGACATG
GACACGGCAGAGGCGACCGAGTTCCTCGAGGCGGTGTGTCTGTTTCCACGGCTGCACACGTTGACGCTGCATGTC
CAGACGCGAGTGCGGCCAGACGACGAGGCCGAAGTGCACTCGGATGCCGATGATGAGGCGGCGGCCGAGATGCTG
GGCCTTTTGCTGAGGCGGCGCAAAGGAGGCGTGGCGTGGCGGCGCGTCACCATCAATGTCGGGGGGTGGCGACGG
GCCATGGTCAGGAGGGTGGGCTACGAATGGAAGAAGCAGAACCAGCGCGGAGTCTTTGCCGAGCGGTGTTTTGTC
ATGGAGGCGCATGAGGAGGGGGGGTATGCGGTGCGAGATGAGGCGTGCCAGAAAGGAAGCCTGAGGCGGCGGCTG
GCGGATCAAGCATAG
Transcript >OphauG2|2421
ATGCAACTTTTTCAAGTCGGTCCATCTGGACCATCTTCGCCGGCTACATACACTCAAAGCCTGCTATACCAAGTC
GTCAAACACCACATTGATGCCCTGCAGACTCTCGAGTTGACGTGCAAGACGGCATTGTTTGGACTCGACGCGCTA
GAGCGGCACGCCACGACGTTGCAGGTGCTTCGTTTGCAGGACCACGTGGGCTTCCAAGACGACAGCAGGACGTGT
CCGACGCTGGGCCACGACTCGGTGCGCGAGCTGGCGTCTGCTCTAGTTCACGTGCACACGCTTGAGCTGGACATG
GACACGGCAGAGGCGACCGAGTTCCTCGAGGCGGTGTGTCTGTTTCCACGGCTGCACACGTTGACGCTGCATGTC
CAGACGCGAGTGCGGCCAGACGACGAGGCCGAAGTGCACTCGGATGCCGATGATGAGGCGGCGGCCGAGATGCTG
GGCCTTTTGCTGAGGCGGCGCAAAGGAGGCGTGGCGTGGCGGCGCGTCACCATCAATGTCGGGGGGTGGCGACGG
GCCATGGTCAGGAGGGTGGGCTACGAATGGAAGAAGCAGAACCAGCGCGGAGTCTTTGCCGAGCGGTGTTTTGTC
ATGGAGGCGCATGAGGAGGGGGGGTATGCGGTGCGAGATGAGGCGTGCCAGAAAGGAAGCCTGAGGCGGCGGCTG
GCGGATCAAGCATAG
Gene >OphauG2|2421
ATGCAACTTTTTCAAGTCGGTCCATCTGGACCATCTTCGCCGGCTACATACACTCAAAGTTGGCGAGCAAAGTGA
ACACCTGCACCAGACATGGGGCAAAGCGACAGGCCTGCTATACCAAGTCGTCAAACACCACATTGATGCCCTGCA
GACTCTCGAGTTGACGTGCAAGACGGCATTGTTTGGACTCGACGCGCTAGAGCGGCACGCCACGACGTTGCAGGT
GCTTCGTTTGCAGGACCACGTGGGCTTCCAAGACGACAGCAGGACGTGTCCGACGCTGGGCCACGACTCGGTGCG
CGAGCTGGCGTCTGCTCTAGTTCACGTGCACACGCTTGAGCTGGACATGGACACGGCAGAGGCGACCGAGTTCCT
CGAGGCGGTGTGTCTGTTTCCACGGCTGCACACGTTGACGCTGCATGTCCAGACGCGAGTGCGGCCAGACGACGA
GGCCGAAGTGCACTCGGATGCCGATGATGAGGCGGCGGCCGAGATGCTGGGCCTTTTGCTGAGGCGGCGCAAAGG
AGGCGTGGCGTGGCGGCGCGTCACCATCAATGTCGGGGGGTGGCGACGGGCCATGGTCAGGAGGGTGGGCTACGA
ATGGAAGAAGCAGAACCAGCGCGGAGTCTTTGCCGAGCGGTGTTTTGTCATGGAGGCGCATGAGGAGGGGGGGTA
TGCGGTGCGAGATGAGGCGTGCCAGAAAGGAAGCCTGAGGCGGCGGCTGGCGGATCAAGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail