Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2419
Gene name
LocationContig_1875:118..1485
Strand-
Gene length (bp)1367
Transcript length (bp)1311
Coding sequence length (bp)1311
Protein length (aa) 437

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04427 Brix Brix domain 2.7E-45 41 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14206|YDD3_SCHPO Brix domain-containing protein C1B9.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B9.03c PE=1 SV=2 1 390 6.0E-93
sp|Q12153|SSF2_YEAST Ribosome biogenesis protein SSF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSF2 PE=1 SV=1 1 425 2.0E-82
sp|P38789|SSF1_YEAST Ribosome biogenesis protein SSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSF1 PE=1 SV=1 1 408 4.0E-81
sp|Q5REM3|SSF1_PONAB Suppressor of SWI4 1 homolog OS=Pongo abelii GN=PPAN PE=2 SV=1 2 398 3.0E-55
sp|Q9NQ55|SSF1_HUMAN Suppressor of SWI4 1 homolog OS=Homo sapiens GN=PPAN PE=2 SV=1 2 398 8.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14206|YDD3_SCHPO Brix domain-containing protein C1B9.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B9.03c PE=1 SV=2 1 390 6.0E-93
sp|Q12153|SSF2_YEAST Ribosome biogenesis protein SSF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSF2 PE=1 SV=1 1 425 2.0E-82
sp|P38789|SSF1_YEAST Ribosome biogenesis protein SSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSF1 PE=1 SV=1 1 408 4.0E-81
sp|Q5REM3|SSF1_PONAB Suppressor of SWI4 1 homolog OS=Pongo abelii GN=PPAN PE=2 SV=1 2 398 3.0E-55
sp|Q9NQ55|SSF1_HUMAN Suppressor of SWI4 1 homolog OS=Homo sapiens GN=PPAN PE=2 SV=1 2 398 8.0E-55
sp|Q91YU8|SSF1_MOUSE Suppressor of SWI4 1 homolog OS=Mus musculus GN=Ppan PE=1 SV=2 2 413 2.0E-53
sp|Q9ASU7|PPAN_ARATH Peter Pan-like protein OS=Arabidopsis thaliana GN=PPAN PE=1 SV=1 30 357 7.0E-49
sp|Q54N44|PPAN_DICDI Peter Pan-like protein OS=Dictyostelium discoideum GN=ppan PE=3 SV=1 31 391 5.0E-48
sp|Q9VDE5|PPAN_DROME Protein Peter pan OS=Drosophila melanogaster GN=ppan PE=1 SV=1 27 414 1.0E-44
[Show less]

GO

GO Term Description Terminal node
GO:0006364 rRNA processing Yes
GO:0019843 rRNA binding Yes
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0016072 rRNA metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0034660 ncRNA metabolic process No
GO:0034470 ncRNA processing No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003723 RNA binding No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup869
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1598
Ophiocordyceps australis 1348a (Ghana) OphauG2|2419 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3471
Ophiocordyceps camponoti-floridani Ophcf2|04575
Ophiocordyceps camponoti-rufipedis Ophun1|6776
Ophiocordyceps kimflemingae Ophio5|7144
Ophiocordyceps subramaniannii Hirsu2|4945

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2419
MARRRTKKRTHAGANNPKPAAAGHASIRDPKSMVIRIGAGQVGSSISQLAADVRRVMEPGTASRLKERRGNKLKD
YTVMCGPLGVTHLLLFSRSETGNTNLRVAATPRGPTMHFRVDKYALCKDVQRIQRHPRGGGKEFLTPPLLVMDGF
TTPEATAKSKVPKHLESLATTVFRSLFPPINPHTTPIKTIRRVLLLKREQSCSDDGTFIINFRHFAITTRPADSS
RPLRRLNAAEKLMTTKTSRHGKMPNLGKLQDIADYMIGGDNGEGYMTDMTSGSEPDTDAEVEVLGASHKKISSAK
ARQAAAHDDDDGKDAADDEQNVERLRVKLVELGPRMRMRLTKVEEGLCGGKIMWHEHIHKTQQQIKELDKRWEQK
KQEKEARRREQKANVERKKAAKEQAKGEDGDDGDDDGDYSDMDVDDLDSEGLEGGDEILGE*
Coding >OphauG2|2419
ATGGCACGCAGACGGACAAAGAAGCGCACGCACGCCGGGGCAAACAACCCCAAGCCTGCAGCTGCCGGCCATGCA
TCCATCCGCGACCCCAAGTCCATGGTGATTCGCATTGGCGCTGGCCAAGTCGGCTCCAGCATCAGCCAGCTGGCC
GCCGACGTGCGGCGCGTCATGGAGCCCGGAACGGCAAGCCGCCTCAAGGAGCGGCGCGGCAACAAGCTCAAGGAC
TATACCGTCATGTGCGGGCCTCTTGGCGTGACGCACCTGCTGCTCTTTTCGCGCTCAGAAACGGGCAATACAAAT
CTACGAGTGGCGGCGACGCCTCGCGGGCCGACGATGCATTTCCGCGTCGACAAGTATGCGCTGTGCAAGGACGTC
CAGCGCATACAGCGGCATCCCCGCGGTGGAGGAAAAGAGTTTTTGACGCCGCCTCTGCTCGTCATGGACGGCTTC
ACCACCCCCGAAGCTACGGCCAAGTCCAAGGTGCCCAAGCACTTGGAATCGCTGGCCACGACTGTGTTTCGCTCC
TTGTTCCCGCCCATCAACCCGCATACGACGCCCATCAAGACAATCCGCAGAGTGCTTCTTCTCAAGCGCGAGCAG
TCTTGCTCCGACGACGGGACTTTTATCATCAATTTCCGACACTTTGCCATTACCACACGGCCTGCAGACTCGTCG
CGGCCGCTACGACGGCTCAACGCTGCTGAGAAGCTCATGACGACCAAGACGAGCCGGCACGGGAAAATGCCCAAT
CTCGGCAAGTTGCAAGACATTGCGGACTACATGATTGGCGGAGACAATGGCGAGGGGTACATGACGGACATGACG
AGTGGCAGCGAGCCCGACACAGACGCCGAAGTCGAAGTCTTGGGCGCGTCGCACAAGAAGATTTCCTCAGCCAAG
GCTCGCCAAGCCGCAGCGCACGACGACGACGACGGCAAGGACGCTGCAGATGACGAGCAAAATGTGGAGCGGCTG
CGCGTCAAGCTGGTTGAGCTGGGGCCGCGGATGCGGATGCGCCTAACAAAGGTGGAAGAAGGGCTTTGTGGGGGC
AAAATCATGTGGCATGAGCACATACACAAGACACAGCAGCAAATCAAGGAGCTTGACAAGCGGTGGGAACAGAAG
AAGCAGGAAAAGGAGGCGCGTCGCAGAGAGCAAAAGGCAAATGTGGAGAGGAAAAAGGCTGCCAAGGAGCAGGCA
AAAGGAGAGGACGGCGACGACGGCGACGACGATGGCGATTATAGCGACATGGATGTGGATGACTTGGACAGCGAG
GGATTGGAAGGGGGCGATGAAATTCTTGGTGAATGA
Transcript >OphauG2|2419
ATGGCACGCAGACGGACAAAGAAGCGCACGCACGCCGGGGCAAACAACCCCAAGCCTGCAGCTGCCGGCCATGCA
TCCATCCGCGACCCCAAGTCCATGGTGATTCGCATTGGCGCTGGCCAAGTCGGCTCCAGCATCAGCCAGCTGGCC
GCCGACGTGCGGCGCGTCATGGAGCCCGGAACGGCAAGCCGCCTCAAGGAGCGGCGCGGCAACAAGCTCAAGGAC
TATACCGTCATGTGCGGGCCTCTTGGCGTGACGCACCTGCTGCTCTTTTCGCGCTCAGAAACGGGCAATACAAAT
CTACGAGTGGCGGCGACGCCTCGCGGGCCGACGATGCATTTCCGCGTCGACAAGTATGCGCTGTGCAAGGACGTC
CAGCGCATACAGCGGCATCCCCGCGGTGGAGGAAAAGAGTTTTTGACGCCGCCTCTGCTCGTCATGGACGGCTTC
ACCACCCCCGAAGCTACGGCCAAGTCCAAGGTGCCCAAGCACTTGGAATCGCTGGCCACGACTGTGTTTCGCTCC
TTGTTCCCGCCCATCAACCCGCATACGACGCCCATCAAGACAATCCGCAGAGTGCTTCTTCTCAAGCGCGAGCAG
TCTTGCTCCGACGACGGGACTTTTATCATCAATTTCCGACACTTTGCCATTACCACACGGCCTGCAGACTCGTCG
CGGCCGCTACGACGGCTCAACGCTGCTGAGAAGCTCATGACGACCAAGACGAGCCGGCACGGGAAAATGCCCAAT
CTCGGCAAGTTGCAAGACATTGCGGACTACATGATTGGCGGAGACAATGGCGAGGGGTACATGACGGACATGACG
AGTGGCAGCGAGCCCGACACAGACGCCGAAGTCGAAGTCTTGGGCGCGTCGCACAAGAAGATTTCCTCAGCCAAG
GCTCGCCAAGCCGCAGCGCACGACGACGACGACGGCAAGGACGCTGCAGATGACGAGCAAAATGTGGAGCGGCTG
CGCGTCAAGCTGGTTGAGCTGGGGCCGCGGATGCGGATGCGCCTAACAAAGGTGGAAGAAGGGCTTTGTGGGGGC
AAAATCATGTGGCATGAGCACATACACAAGACACAGCAGCAAATCAAGGAGCTTGACAAGCGGTGGGAACAGAAG
AAGCAGGAAAAGGAGGCGCGTCGCAGAGAGCAAAAGGCAAATGTGGAGAGGAAAAAGGCTGCCAAGGAGCAGGCA
AAAGGAGAGGACGGCGACGACGGCGACGACGATGGCGATTATAGCGACATGGATGTGGATGACTTGGACAGCGAG
GGATTGGAAGGGGGCGATGAAATTCTTGGTGAATGA
Gene >OphauG2|2419
ATGGCACGCAGACGGACAAAGAAGCGCACGCACGCCGGGGCAAACAACCCCAAGCCTGCAGCTGCCGGCCATGCA
TCCATCCGCGACCCCAAGTCCATGGTGATTCGCATTGGCGCTGGCCAAGTCGGCTCCAGCATCAGCCAGCTGGCC
GCCGACGTGCGGCGCGTCATGGAGCCCGGAACGGCAAGCCGCCTCAAGGAGCGGCGCGGCAACAAGCTCAAGGAC
TATACCGTCATGTGCGGGCCTCTTGGCGTGACGCACCTGCTGCTCTTTTCGCGCTCAGAAACGGGCAATACAAAT
CTACGAGTGGCGGCGACGCCTCGCGGGCCGACGATGCATTTCCGCGTCGACAAGTATGCGCTGTGCAAGGACGTC
CAGCGCATACAGCGGCATCCCCGCGGTGGAGGAAAAGAGTTTTTGACGCCGCCTCTGGTAAGGGCTTGTAAAAGT
GTCTTGTCGACGCTTGGCTATGCTGATGCCAGGTGCAGCTCGTCATGGACGGCTTCACCACCCCCGAAGCTACGG
CCAAGTCCAAGGTGCCCAAGCACTTGGAATCGCTGGCCACGACTGTGTTTCGCTCCTTGTTCCCGCCCATCAACC
CGCATACGACGCCCATCAAGACAATCCGCAGAGTGCTTCTTCTCAAGCGCGAGCAGTCTTGCTCCGACGACGGGA
CTTTTATCATCAATTTCCGACACTTTGCCATTACCACACGGCCTGCAGACTCGTCGCGGCCGCTACGACGGCTCA
ACGCTGCTGAGAAGCTCATGACGACCAAGACGAGCCGGCACGGGAAAATGCCCAATCTCGGCAAGTTGCAAGACA
TTGCGGACTACATGATTGGCGGAGACAATGGCGAGGGGTACATGACGGACATGACGAGTGGCAGCGAGCCCGACA
CAGACGCCGAAGTCGAAGTCTTGGGCGCGTCGCACAAGAAGATTTCCTCAGCCAAGGCTCGCCAAGCCGCAGCGC
ACGACGACGACGACGGCAAGGACGCTGCAGATGACGAGCAAAATGTGGAGCGGCTGCGCGTCAAGCTGGTTGAGC
TGGGGCCGCGGATGCGGATGCGCCTAACAAAGGTGGAAGAAGGGCTTTGTGGGGGCAAAATCATGTGGCATGAGC
ACATACACAAGACACAGCAGCAAATCAAGGAGCTTGACAAGCGGTGGGAACAGAAGAAGCAGGAAAAGGAGGCGC
GTCGCAGAGAGCAAAAGGCAAATGTGGAGAGGAAAAAGGCTGCCAAGGAGCAGGCAAAAGGAGAGGACGGCGACG
ACGGCGACGACGATGGCGATTATAGCGACATGGATGTGGATGACTTGGACAGCGAGGGATTGGAAGGGGGCGATG
AAATTCTTGGTGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail