Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|241
Gene name
LocationContig_1049:668..2709
Strand+
Gene length (bp)2041
Transcript length (bp)1893
Coding sequence length (bp)1893
Protein length (aa) 631

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 4.4E-03 439 474
PF00400 WD40 WD domain, G-beta repeat 1.1E-03 568 604
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 1.6E-05 361 415

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R1K5|FZR_MOUSE Fizzy-related protein homolog OS=Mus musculus GN=Fzr1 PE=1 SV=1 105 614 1.0E-157
sp|Q9UM11|FZR_HUMAN Fizzy-related protein homolog OS=Homo sapiens GN=FZR1 PE=1 SV=2 105 618 2.0E-155
sp|O13286|SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1 117 606 3.0E-149
sp|Q8L3Z8|FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana GN=FZR2 PE=1 SV=1 300 606 2.0E-142
sp|Q8VZS9|FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana GN=FZR1 PE=1 SV=1 120 620 3.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R1K5|FZR_MOUSE Fizzy-related protein homolog OS=Mus musculus GN=Fzr1 PE=1 SV=1 105 614 1.0E-157
sp|Q9UM11|FZR_HUMAN Fizzy-related protein homolog OS=Homo sapiens GN=FZR1 PE=1 SV=2 105 618 2.0E-155
sp|O13286|SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1 117 606 3.0E-149
sp|Q8L3Z8|FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana GN=FZR2 PE=1 SV=1 300 606 2.0E-142
sp|Q8VZS9|FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana GN=FZR1 PE=1 SV=1 120 620 3.0E-138
sp|Q8LPL5|FZR3_ARATH Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana GN=FZR3 PE=1 SV=1 312 606 9.0E-137
sp|P53197|CDH1_YEAST APC/C activator protein CDH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDH1 PE=1 SV=1 126 608 3.0E-135
sp|O94423|MFR1_SCHPO Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr1 PE=1 SV=1 284 610 5.0E-135
sp|Q54KM3|CDH1_DICDI Anaphase-promoting complex subunit cdh1 OS=Dictyostelium discoideum GN=cdh1 PE=3 SV=1 284 618 1.0E-129
sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 234 609 1.0E-114
sp|Q9SZA4|CDC21_ARATH Cell division cycle 20.1, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-1 PE=1 SV=1 305 607 9.0E-109
sp|Q9S7I8|CDC22_ARATH Cell division cycle 20.2, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-2 PE=1 SV=1 305 607 1.0E-108
sp|Q5H7C0|CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 299 617 2.0E-106
sp|Q62623|CDC20_RAT Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2 299 617 4.0E-106
sp|Q9JJ66|CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus GN=Cdc20 PE=1 SV=2 299 617 4.0E-106
sp|Q12834|CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 299 617 1.0E-105
sp|Q3E906|CD205_ARATH Cell division cycle 20.5, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-5 PE=1 SV=2 294 610 2.0E-104
sp|Q9S7H3|CD203_ARATH Cell division cycle 20.3, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-3 PE=3 SV=1 305 618 9.0E-102
sp|Q4PSE4|CDC24_ARATH Cell division cycle 20.4, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-4 PE=2 SV=1 300 610 3.0E-101
sp|P78972|SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slp1 PE=1 SV=1 294 606 2.0E-94
sp|F4K5R6|CDC26_ARATH Cell division cycle 20.6, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-6 PE=3 SV=1 320 610 4.0E-87
sp|P26309|CDC20_YEAST APC/C activator protein CDC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC20 PE=1 SV=2 305 620 4.0E-70
sp|Q86Y33|CD20B_HUMAN Cell division cycle protein 20 homolog B OS=Homo sapiens GN=CDC20B PE=1 SV=3 320 606 7.0E-61
sp|O94411|MFR2_SCHPO Meiotic fizzy-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr2 PE=1 SV=1 306 607 7.0E-43
sp|P50082|AMA1_YEAST Meiosis-specific APC/C activator protein AMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMA1 PE=1 SV=2 299 620 3.0E-40
sp|Q09786|YA98_SCHPO Uncharacterized WD repeat-containing protein C13G6.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13G6.08 PE=3 SV=1 188 572 1.0E-38
sp|Q09373|FZY1_CAEEL WD repeat-containing protein fzy-1 OS=Caenorhabditis elegans GN=fzy-1 PE=3 SV=2 299 606 1.0E-29
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 342 609 1.0E-20
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 345 605 5.0E-18
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 344 605 1.0E-17
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 339 605 3.0E-17
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 337 604 8.0E-17
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 375 628 9.0E-17
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 344 605 2.0E-16
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 348 603 5.0E-16
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 344 603 6.0E-16
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 386 618 6.0E-16
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 344 605 7.0E-16
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 365 605 3.0E-15
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 344 603 3.0E-15
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 343 604 7.0E-15
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 365 603 1.0E-14
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 366 603 2.0E-14
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 375 628 2.0E-14
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 375 610 2.0E-14
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 375 610 3.0E-14
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 343 605 7.0E-14
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 345 604 8.0E-14
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 345 605 1.0E-13
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 344 603 1.0E-13
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 345 604 1.0E-13
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 343 609 2.0E-13
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 375 628 2.0E-13
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 375 628 3.0E-13
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 343 605 3.0E-13
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 343 605 3.0E-13
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 343 605 3.0E-13
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 343 605 3.0E-13
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 366 619 4.0E-13
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 337 605 4.0E-13
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 343 603 4.0E-13
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 343 605 4.0E-13
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 343 609 4.0E-13
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 343 605 6.0E-13
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 365 609 6.0E-13
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 343 605 7.0E-13
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 343 605 7.0E-13
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 344 603 8.0E-13
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 345 603 9.0E-13
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 387 603 1.0E-12
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 345 526 1.0E-12
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 343 605 1.0E-12
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 358 618 1.0E-12
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 345 603 2.0E-12
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 378 603 2.0E-12
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 345 603 2.0E-12
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 343 605 2.0E-12
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 343 605 2.0E-12
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 343 609 2.0E-12
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 345 526 3.0E-12
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 343 603 3.0E-12
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 343 609 3.0E-12
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 343 605 3.0E-12
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 343 627 4.0E-12
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 345 603 4.0E-12
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 345 603 4.0E-12
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 344 603 5.0E-12
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 366 604 5.0E-12
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 345 603 5.0E-12
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 364 604 6.0E-12
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 345 532 9.0E-12
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 366 530 1.0E-11
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 341 603 1.0E-11
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 364 620 1.0E-11
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 378 604 1.0E-11
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 342 540 1.0E-11
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 366 618 1.0E-11
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 366 618 1.0E-11
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 366 618 1.0E-11
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 366 618 1.0E-11
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 343 627 2.0E-11
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 398 605 2.0E-11
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 398 605 2.0E-11
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 343 627 3.0E-11
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 345 603 4.0E-11
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 345 603 4.0E-11
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 345 603 4.0E-11
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 345 603 4.0E-11
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 398 605 4.0E-11
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 366 519 4.0E-11
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 387 601 4.0E-11
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 355 605 5.0E-11
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 375 605 5.0E-11
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 345 603 5.0E-11
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 345 605 6.0E-11
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 366 618 6.0E-11
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 343 627 7.0E-11
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 343 605 8.0E-11
sp|Q5E959|STRAP_BOVIN Serine-threonine kinase receptor-associated protein OS=Bos taurus GN=STRAP PE=2 SV=1 389 611 8.0E-11
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 347 603 1.0E-10
sp|Q5XIG8|STRAP_RAT Serine-threonine kinase receptor-associated protein OS=Rattus norvegicus GN=Strap PE=1 SV=1 389 611 1.0E-10
sp|Q8BX17|GEMI5_MOUSE Gem-associated protein 5 OS=Mus musculus GN=Gemin5 PE=1 SV=2 367 508 1.0E-10
sp|Q9Y3F4|STRAP_HUMAN Serine-threonine kinase receptor-associated protein OS=Homo sapiens GN=STRAP PE=1 SV=1 389 611 1.0E-10
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 347 603 1.0E-10
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 347 603 1.0E-10
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 343 605 2.0E-10
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 365 610 2.0E-10
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 347 603 2.0E-10
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 366 618 2.0E-10
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 398 605 2.0E-10
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 343 605 2.0E-10
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 366 619 2.0E-10
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 366 618 3.0E-10
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 344 603 3.0E-10
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 366 604 3.0E-10
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 364 605 3.0E-10
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 343 609 3.0E-10
sp|Q9Z1Z2|STRAP_MOUSE Serine-threonine kinase receptor-associated protein OS=Mus musculus GN=Strap PE=1 SV=2 389 611 3.0E-10
sp|P0CS38|HIR1_CRYNJ Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIR1 PE=3 SV=1 366 498 3.0E-10
sp|P0CS39|HIR1_CRYNB Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIR1 PE=3 SV=1 366 498 3.0E-10
sp|Q2GVT8|SEC31_CHAGB Protein transport protein SEC31 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC31 PE=3 SV=1 339 507 3.0E-10
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 347 603 4.0E-10
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 366 619 4.0E-10
sp|Q873A1|SEC31_NEUCR Protein transport protein sec31 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec31 PE=3 SV=1 339 518 4.0E-10
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 378 603 5.0E-10
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 344 605 5.0E-10
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 366 619 5.0E-10
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 359 618 6.0E-10
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 347 603 6.0E-10
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 359 618 7.0E-10
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 367 603 7.0E-10
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 366 618 1.0E-09
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 347 603 1.0E-09
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 367 603 1.0E-09
sp|Q9Y6I7|WSB1_HUMAN WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 373 604 1.0E-09
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 344 603 1.0E-09
sp|Q5BDU4|HIR1_EMENI Protein hir1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hir1 PE=3 SV=2 375 501 1.0E-09
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 344 518 1.0E-09
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 367 603 1.0E-09
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 344 606 2.0E-09
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 345 603 2.0E-09
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 381 607 2.0E-09
sp|Q8TEQ6|GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens GN=GEMIN5 PE=1 SV=3 367 508 2.0E-09
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 347 603 2.0E-09
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 344 579 2.0E-09
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 381 607 2.0E-09
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 365 605 2.0E-09
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 386 603 2.0E-09
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 333 603 2.0E-09
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 329 475 3.0E-09
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 440 603 3.0E-09
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 364 619 3.0E-09
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 343 627 3.0E-09
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 365 562 4.0E-09
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 366 619 4.0E-09
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 386 603 4.0E-09
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 366 604 4.0E-09
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 366 604 4.0E-09
sp|Q7SYD5|SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio GN=sec31a PE=2 SV=1 283 524 4.0E-09
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 366 604 4.0E-09
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 340 603 5.0E-09
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 440 603 5.0E-09
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 373 605 5.0E-09
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 365 605 6.0E-09
sp|A4RD35|SEC31_MAGO7 Protein transport protein SEC31 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC31 PE=3 SV=1 364 485 6.0E-09
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 347 603 7.0E-09
sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 294 613 7.0E-09
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 364 605 7.0E-09
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 364 605 7.0E-09
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 363 603 7.0E-09
sp|Q6CSI1|HAT2_KLULA Histone acetyltransferase type B subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAT2 PE=3 SV=1 427 607 7.0E-09
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 366 604 7.0E-09
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 440 603 8.0E-09
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 458 609 9.0E-09
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 367 603 9.0E-09
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 340 613 1.0E-08
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 375 604 1.0E-08
sp|Q8K4P0|WDR33_MOUSE pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 294 613 1.0E-08
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 440 603 1.0E-08
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 364 604 1.0E-08
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 381 607 1.0E-08
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 398 605 1.0E-08
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 366 619 1.0E-08
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 387 604 1.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 441 603 2.0E-08
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 375 603 2.0E-08
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 339 603 2.0E-08
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 375 603 2.0E-08
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 375 628 2.0E-08
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 386 605 2.0E-08
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 344 603 2.0E-08
sp|A1C6X5|SEC31_ASPCL Protein transport protein sec31 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec31 PE=3 SV=1 364 515 2.0E-08
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 362 605 2.0E-08
sp|Q09731|BU107_SCHPO UBP9-binding protein bun107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bun107 PE=1 SV=1 418 609 2.0E-08
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 440 603 2.0E-08
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 366 604 2.0E-08
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 363 603 2.0E-08
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 354 608 2.0E-08
sp|O17468|HIRA_DROME Protein HIRA homolog OS=Drosophila melanogaster GN=Hira PE=1 SV=2 362 554 2.0E-08
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 356 607 2.0E-08
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 366 604 2.0E-08
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 386 605 2.0E-08
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 387 605 2.0E-08
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 362 605 2.0E-08
sp|B4HND9|WDR48_DROSE WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 414 609 2.0E-08
sp|B4QB64|WDR48_DROSI WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 414 609 2.0E-08
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 440 603 3.0E-08
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 364 619 3.0E-08
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 417 603 3.0E-08
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 417 603 3.0E-08
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 435 608 3.0E-08
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 366 604 3.0E-08
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 387 605 3.0E-08
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 343 609 3.0E-08
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 400 605 3.0E-08
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 440 609 3.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 364 603 4.0E-08
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 414 605 4.0E-08
sp|O14435|GBB_CRYPA Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 345 604 4.0E-08
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 414 605 4.0E-08
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 362 605 4.0E-08
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 366 604 4.0E-08
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 366 619 5.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 364 604 5.0E-08
sp|P17343|GBB1_CAEEL Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 440 605 5.0E-08
sp|Q61ZF6|GBB1_CAEBR Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 440 605 5.0E-08
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 386 605 5.0E-08
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 386 605 5.0E-08
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 378 603 5.0E-08
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 364 515 6.0E-08
sp|Q7RZI0|HIR1_NEUCR Protein hir-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hir-1 PE=3 SV=2 375 610 6.0E-08
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 378 603 6.0E-08
sp|O22785|PR19B_ARATH Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 417 605 6.0E-08
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 417 605 7.0E-08
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 366 619 8.0E-08
sp|Q32SG6|HIRA_MAIZE Protein HIRA OS=Zea mays PE=1 SV=1 375 555 8.0E-08
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 366 605 8.0E-08
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 366 619 8.0E-08
sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 440 605 8.0E-08
sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 440 605 8.0E-08
sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 440 605 8.0E-08
sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 440 605 8.0E-08
sp|P20053|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 396 604 8.0E-08
sp|B4MFM2|WDR48_DROVI WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 414 609 9.0E-08
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 366 519 9.0E-08
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 414 609 9.0E-08
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 414 609 9.0E-08
sp|Q6PH57|GBB1_DANRE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 440 605 9.0E-08
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 340 600 1.0E-07
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 340 600 1.0E-07
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 340 600 1.0E-07
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 340 600 1.0E-07
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 364 619 1.0E-07
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 417 603 1.0E-07
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 340 519 1.0E-07
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 400 605 1.0E-07
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 347 614 1.0E-07
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 364 603 1.0E-07
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 414 609 1.0E-07
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 414 609 1.0E-07
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 343 609 1.0E-07
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 343 609 1.0E-07
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 343 609 1.0E-07
sp|P36408|GBB_DICDI Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 366 604 1.0E-07
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 343 609 1.0E-07
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 343 609 1.0E-07
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 336 609 1.0E-07
sp|Q5GIS3|GBB_PINFU Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 440 619 1.0E-07
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 329 506 1.0E-07
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 343 609 1.0E-07
sp|Q1LZ08|WDR48_DROME WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 414 609 1.0E-07
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 364 627 1.0E-07
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 343 609 1.0E-07
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 343 609 1.0E-07
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 398 605 1.0E-07
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 378 626 1.0E-07
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 375 606 1.0E-07
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 343 609 1.0E-07
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 347 614 1.0E-07
sp|Q8NEZ3|WDR19_HUMAN WD repeat-containing protein 19 OS=Homo sapiens GN=WDR19 PE=1 SV=2 329 427 1.0E-07
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 347 603 2.0E-07
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 309 565 2.0E-07
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 365 562 2.0E-07
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 366 603 2.0E-07
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 308 515 2.0E-07
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 308 515 2.0E-07
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 341 516 2.0E-07
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 400 605 2.0E-07
sp|Q2GSJ9|HIR1_CHAGB Protein HIR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HIR1 PE=3 SV=1 362 520 2.0E-07
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 435 608 2.0E-07
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 364 605 2.0E-07
sp|Q08706|GBB_LYMST Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 440 619 2.0E-07
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 366 519 2.0E-07
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 381 605 2.0E-07
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 362 620 2.0E-07
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 397 605 2.0E-07
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 444 608 2.0E-07
sp|Q1DX43|SEC31_COCIM Protein transport protein SEC31 OS=Coccidioides immitis (strain RS) GN=SEC31 PE=3 SV=1 364 564 2.0E-07
sp|Q8SQS4|TAF5_ENCCU Transcription initiation factor TFIID subunit 5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TAF5 PE=1 SV=1 347 475 2.0E-07
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 373 605 2.0E-07
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 400 624 2.0E-07
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 378 506 2.0E-07
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 365 562 3.0E-07
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 365 530 3.0E-07
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 364 627 3.0E-07
sp|Q3UGF1|WDR19_MOUSE WD repeat-containing protein 19 OS=Mus musculus GN=Wdr19 PE=1 SV=1 329 427 3.0E-07
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 377 515 3.0E-07
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 378 575 3.0E-07
sp|B3MET8|WDR48_DROAN WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 414 609 3.0E-07
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 363 603 3.0E-07
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 366 602 3.0E-07
sp|Q2TZG4|PFS2_ASPOR Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 366 600 3.0E-07
sp|B4J8H6|WDR48_DROGR WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 414 609 3.0E-07
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 392 605 3.0E-07
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 376 609 3.0E-07
sp|A3GFK8|SEC31_PICST Protein transport protein SEC31 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC31 PE=3 SV=2 364 484 3.0E-07
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 343 609 3.0E-07
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 444 608 3.0E-07
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 366 605 3.0E-07
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 400 603 4.0E-07
sp|P20053|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 347 507 4.0E-07
sp|Q5GIS3|GBB_PINFU Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 333 604 4.0E-07
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 366 605 4.0E-07
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 414 605 4.0E-07
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 344 603 4.0E-07
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 365 605 4.0E-07
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 373 604 4.0E-07
sp|Q5ZL33|STRAP_CHICK Serine-threonine kinase receptor-associated protein OS=Gallus gallus GN=STRAP PE=2 SV=2 389 603 4.0E-07
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 387 475 5.0E-07
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 364 605 5.0E-07
sp|Q4IBR4|HIR1_GIBZE Protein HIR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HIR1 PE=3 SV=1 375 520 5.0E-07
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 343 609 5.0E-07
sp|Q0UNC6|HIR1_PHANO Protein HIR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HIR1 PE=3 SV=1 361 501 5.0E-07
sp|O35242|FAN_MOUSE Protein FAN OS=Mus musculus GN=Nsmaf PE=1 SV=2 363 605 5.0E-07
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 387 475 6.0E-07
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 345 604 6.0E-07
sp|Q61011|GBB3_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 440 619 6.0E-07
sp|Q6FJS0|PFS2_CANGA Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 347 604 6.0E-07
sp|Q2UBU2|HIR1_ASPOR Protein HIR1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=HIR1 PE=3 SV=1 362 501 6.0E-07
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 400 603 7.0E-07
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 345 604 7.0E-07
sp|P62882|GBB5_RAT Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 349 604 7.0E-07
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 378 604 7.0E-07
sp|Q96J01|THOC3_HUMAN THO complex subunit 3 OS=Homo sapiens GN=THOC3 PE=1 SV=1 397 605 7.0E-07
sp|Q29RH4|THOC3_BOVIN THO complex subunit 3 OS=Bos taurus GN=THOC3 PE=2 SV=1 397 605 7.0E-07
sp|P62881|GBB5_MOUSE Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 349 604 7.0E-07
sp|B4KRQ4|WDR48_DROMO WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 414 609 7.0E-07
sp|Q5AAU3|SEC31_CANAL Protein transport protein SEC31 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC31 PE=3 SV=1 364 484 7.0E-07
sp|A5DB75|SEC31_PICGU Protein transport protein SEC31 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC31 PE=3 SV=2 364 484 7.0E-07
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 343 609 7.0E-07
sp|Q8VE80|THOC3_MOUSE THO complex subunit 3 OS=Mus musculus GN=Thoc3 PE=2 SV=1 397 605 7.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 344 478 8.0E-07
sp|Q9W5Z5|WSB1_TAKRU WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 378 610 8.0E-07
sp|Q6CGP9|PFS2_YARLI Polyadenylation factor subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFS2 PE=3 SV=1 347 604 9.0E-07
sp|P79147|GBB3_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 440 619 9.0E-07
sp|Q5RDY7|GBB5_PONAB Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 349 604 9.0E-07
sp|O14775|GBB5_HUMAN Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 349 604 9.0E-07
sp|Q9AV81|PRP19_ORYSJ Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 405 605 9.0E-07
sp|P52287|GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 440 619 9.0E-07
sp|Q80ZD0|GBB5_TAMST Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 349 604 9.0E-07
sp|Q5F3X8|SC31A_CHICK Protein transport protein Sec31A OS=Gallus gallus GN=SEC31A PE=2 SV=1 378 553 9.0E-07
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 377 515 9.0E-07
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 364 603 1.0E-06
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 387 475 1.0E-06
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 355 609 1.0E-06
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 292 602 1.0E-06
sp|P36408|GBB_DICDI Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 440 605 1.0E-06
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 366 486 1.0E-06
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 375 507 1.0E-06
sp|O22468|MSI2_ARATH WD-40 repeat-containing protein MSI2 OS=Arabidopsis thaliana GN=MSI2 PE=2 SV=1 441 605 1.0E-06
sp|Q15269|PWP2_HUMAN Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2 364 606 1.0E-06
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 378 610 1.0E-06
sp|P16520|GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 440 619 1.0E-06
sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 440 605 1.0E-06
sp|Q5A7Q3|PRP46_CANAL Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 343 603 1.0E-06
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 360 618 1.0E-06
sp|Q4P553|HAT2_USTMA Histone acetyltransferase type B subunit 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT2 PE=3 SV=2 400 519 1.0E-06
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 343 609 1.0E-06
sp|Q5XI13|GRWD1_RAT Glutamate-rich WD repeat-containing protein 1 OS=Rattus norvegicus GN=Grwd1 PE=2 SV=1 372 515 1.0E-06
sp|Q810D6|GRWD1_MOUSE Glutamate-rich WD repeat-containing protein 1 OS=Mus musculus GN=Grwd1 PE=1 SV=2 372 515 1.0E-06
sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 440 605 1.0E-06
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 378 604 1.0E-06
sp|Q1JQD2|GRWD1_BOVIN Glutamate-rich WD repeat-containing protein 1 OS=Bos taurus GN=GRWD1 PE=2 SV=1 372 515 1.0E-06
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 458 605 2.0E-06
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 487 605 2.0E-06
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 400 603 2.0E-06
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 344 473 2.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 387 475 2.0E-06
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 439 603 2.0E-06
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 343 473 2.0E-06
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 364 619 2.0E-06
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 365 506 2.0E-06
sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 345 604 2.0E-06
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 378 506 2.0E-06
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 394 607 2.0E-06
sp|Q6PNB6|GBB5_RABIT Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 349 604 2.0E-06
sp|Q6BU94|PRP46_DEBHA Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 343 603 2.0E-06
sp|Q5RFQ3|PWP2_PONAB Periodic tryptophan protein 2 homolog OS=Pongo abelii GN=PWP2 PE=2 SV=1 364 606 2.0E-06
sp|Q9FKT5|THOC3_ARATH THO complex subunit 3 OS=Arabidopsis thaliana GN=THO3 PE=1 SV=1 444 605 2.0E-06
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 378 603 2.0E-06
sp|Q75LV5|YAO_ORYSJ U3 snoRNP-associated protein-like YAOH OS=Oryza sativa subsp. japonica GN=Os03g0625900 PE=2 SV=1 420 610 2.0E-06
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 400 616 2.0E-06
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 484 605 2.0E-06
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 357 614 2.0E-06
sp|Q9BQ67|GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens GN=GRWD1 PE=1 SV=1 372 515 2.0E-06
sp|P31146|COR1A_HUMAN Coronin-1A OS=Homo sapiens GN=CORO1A PE=1 SV=4 400 610 2.0E-06
sp|Q652L2|HIRA_ORYSJ Protein HIRA OS=Oryza sativa subsp. japonica GN=Os09g0567700 PE=2 SV=1 375 555 2.0E-06
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 364 603 2.0E-06
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 487 605 3.0E-06
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 487 605 3.0E-06
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 487 605 3.0E-06
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 487 605 3.0E-06
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 487 605 3.0E-06
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 355 609 3.0E-06
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 444 627 3.0E-06
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 364 619 3.0E-06
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 366 498 3.0E-06
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 444 627 3.0E-06
sp|Q61011|GBB3_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 345 604 3.0E-06
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 366 474 3.0E-06
sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 331 604 3.0E-06
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 363 603 3.0E-06
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 418 610 3.0E-06
sp|P33215|NEDD1_MOUSE Protein NEDD1 OS=Mus musculus GN=Nedd1 PE=1 SV=2 329 520 3.0E-06
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 395 607 3.0E-06
sp|Q9XF57|PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana GN=PEX7 PE=1 SV=2 387 506 3.0E-06
sp|O94244|HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis16 PE=1 SV=1 399 516 3.0E-06
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 341 528 3.0E-06
sp|Q92636|FAN_HUMAN Protein FAN OS=Homo sapiens GN=NSMAF PE=1 SV=2 363 605 3.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 364 603 4.0E-06
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 355 609 4.0E-06
sp|Q6PH57|GBB1_DANRE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 345 604 4.0E-06
sp|P52287|GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 345 604 4.0E-06
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 378 506 4.0E-06
sp|B0X2V9|WDR48_CULQU WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 418 609 4.0E-06
sp|P26308|GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 440 605 4.0E-06
sp|O43818|U3IP2_HUMAN U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1 375 494 4.0E-06
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 400 616 4.0E-06
sp|P87314|HIR1_SCHPO Protein hir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hip1 PE=1 SV=1 375 498 4.0E-06
sp|P40968|PRP17_YEAST Pre-mRNA-processing factor 17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC40 PE=1 SV=2 439 603 4.0E-06
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 344 603 4.0E-06
sp|Q6CSI1|HAT2_KLULA Histone acetyltransferase type B subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAT2 PE=3 SV=1 377 519 5.0E-06
sp|P16520|GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 345 604 5.0E-06
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 366 497 5.0E-06
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 344 603 5.0E-06
sp|Q20636|GBB2_CAEEL Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 393 604 5.0E-06
sp|G0SA60|SEC13_CHATD Protein transport protein SEC13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=SEC13 PE=3 SV=2 418 604 5.0E-06
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 332 517 5.0E-06
sp|Q10282|GBB_SCHPO Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2 401 604 5.0E-06
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 344 603 5.0E-06
sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 440 605 5.0E-06
sp|Q5FVN8|WSDU1_RAT WD repeat, SAM and U-box domain-containing protein 1 OS=Rattus norvegicus GN=Wdsub1 PE=2 SV=1 344 507 5.0E-06
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 344 603 5.0E-06
sp|Q9LXN4|HIRA_ARATH Protein HIRA OS=Arabidopsis thaliana GN=HIRA PE=1 SV=2 375 555 5.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 364 603 6.0E-06
sp|O74340|DCA13_SCHPO Protein sof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sof1 PE=3 SV=1 379 605 6.0E-06
sp|Q2GSM6|SEC13_CHAGB Protein transport protein SEC13 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC13 PE=3 SV=1 418 604 6.0E-06
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 363 603 6.0E-06
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 332 603 6.0E-06
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 400 616 6.0E-06
sp|Q8BU03|PWP2_MOUSE Periodic tryptophan protein 2 homolog OS=Mus musculus GN=Pwp2 PE=1 SV=1 364 606 6.0E-06
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 400 616 6.0E-06
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 399 605 7.0E-06
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 344 595 7.0E-06
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 366 474 7.0E-06
sp|O22466|MSI1_SOLLC WD-40 repeat-containing protein MSI1 OS=Solanum lycopersicum GN=MSI1 PE=2 SV=1 343 506 7.0E-06
sp|Q8NA23|WDR31_HUMAN WD repeat-containing protein 31 OS=Homo sapiens GN=WDR31 PE=2 SV=1 364 506 7.0E-06
sp|O82266|SWA1_ARATH Protein SLOW WALKER 1 OS=Arabidopsis thaliana GN=SWA1 PE=2 SV=1 364 629 7.0E-06
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 440 605 7.0E-06
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 440 605 7.0E-06
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 440 605 7.0E-06
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 364 619 8.0E-06
sp|Q0CYG9|SEC31_ASPTN Protein transport protein sec31 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec31 PE=3 SV=1 364 507 8.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 364 603 9.0E-06
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 366 619 9.0E-06
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 391 607 9.0E-06
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 366 506 9.0E-06
sp|P79147|GBB3_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 345 604 9.0E-06
sp|O42611|HIRA_TAKRU Protein HIRA OS=Takifugu rubripes GN=hira PE=2 SV=1 358 506 9.0E-06
sp|Q86HX1|HIRA_DICDI Protein HIRA OS=Dictyostelium discoideum GN=hira PE=3 SV=1 375 555 9.0E-06
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 388 529 9.0E-06
sp|Q32SG6|HIRA_MAIZE Protein HIRA OS=Zea mays PE=1 SV=1 460 603 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|241
MRSQPKSPTLSNPMSVSAGKAVDDSQAILPSDTPRPSTPPPQLLRERPATDRLSVRYGKVVAPGTPAPQDITDCT
HGMERVPSKGSQRDHEAVDVGTVDGKHLRELQRTLCESPPNASPHRKRQRINGDRFIPSRSGQDLQASFSLLHED
ASPASPSKQKKRTPHGELHFQKTEEANRTFSTLLRAELFESSVPHASSRTAYPSGNVLPNFAQVSANDGTRATTP
PGSNAATSLPSSLTPSTPHKNLFTYMSPHQQQSIAGHPTPTKTPQSRHGPSLDARAEIYSLSPVRLGSQQLLLSP
RRQSRAVSKVPYKVLDAPELADDFYLNLVDWGSANVLGVGLGSSVYMWNAQTSKVNKLCTLEDDTVTSVSWIQKG
THLAIGTGKGLVQIWDAEKTRRLRTMTGHTARVGSLAWNSHVLTSGSRDRLIYHRDVRSSDQWMKKLVGHKQEVC
GLKWNCEDGQLASGGNDNKLIVWDRLSETPLWKFSEHTAAVKAISWSPHQRGLLSSGGGTADRRIIFHDTVRGSV
INEIDTGSQVCNIAWSRNTNEIVSTHGYSQNQIVVWKYPSMTQVASLTGHTYRVLYLAMSPDGRIVVTGAGDETL
RFWSVFGRRPGTREEGESGGGRLADWSIIR*
Coding >OphauG2|241
ATGAGAAGCCAACCAAAATCCCCGACTCTGTCGAATCCAATGTCTGTATCAGCCGGCAAGGCTGTTGACGATTCC
CAAGCTATTCTACCATCCGACACGCCCCGACCCTCTACGCCTCCACCCCAGTTATTGCGGGAACGTCCTGCAACC
GATCGCTTGAGCGTACGGTATGGGAAAGTGGTCGCCCCTGGCACCCCTGCTCCCCAGGACATTACGGATTGCACC
CATGGCATGGAACGCGTTCCATCCAAGGGGTCTCAACGCGATCACGAGGCCGTTGATGTCGGCACTGTCGATGGA
AAACACCTAAGAGAGCTACAGCGCACCCTTTGCGAGAGTCCGCCAAACGCCAGTCCTCATCGTAAAAGGCAGCGA
ATAAATGGCGATCGTTTTATCCCCTCGCGGTCTGGCCAAGACTTGCAAGCTAGCTTCTCTCTTCTCCATGAGGAC
GCTTCTCCCGCATCACCGTCAAAACAAAAGAAGCGGACCCCCCATGGAGAATTGCACTTCCAGAAGACCGAAGAG
GCAAACCGTACCTTTTCAACACTGCTCCGCGCCGAGCTCTTCGAAAGCTCAGTCCCTCATGCCTCCTCACGTACA
GCATATCCGTCTGGAAATGTCTTACCCAACTTCGCTCAGGTTTCTGCCAATGATGGCACACGAGCTACAACACCC
CCTGGTAGCAATGCGGCCACGTCTCTGCCCTCGTCGTTGACGCCATCAACTCCCCATAAAAACCTCTTTACTTAC
ATGTCTCCTCATCAACAACAAAGCATAGCCGGTCACCCGACCCCAACAAAGACGCCACAAAGCCGTCACGGCCCC
AGCTTGGATGCACGTGCCGAGATCTACAGCTTGTCCCCCGTTCGTCTGGGCAGTCAACAGTTGCTCTTGAGCCCA
CGCCGGCAGTCTCGAGCCGTGAGCAAGGTGCCCTACAAAGTTCTTGACGCCCCCGAGCTAGCAGATGACTTCTAC
CTGAACCTTGTCGACTGGGGTAGTGCCAACGTTCTTGGCGTTGGACTTGGGTCCAGTGTGTACATGTGGAATGCA
CAGACCAGTAAAGTTAACAAACTCTGCACACTCGAGGACGACACGGTGACAAGTGTTTCATGGATTCAAAAGGGC
ACGCATCTTGCCATCGGTACCGGCAAGGGCCTCGTTCAAATTTGGGATGCTGAAAAAACACGAAGGTTGCGCACC
ATGACGGGCCATACAGCTCGTGTTGGGTCGCTTGCCTGGAACTCGCATGTCCTGACATCTGGCTCACGTGACAGG
CTCATCTATCATAGAGATGTGCGCTCCTCGGATCAGTGGATGAAGAAGCTTGTTGGACACAAACAAGAGGTTTGC
GGACTAAAATGGAATTGCGAAGATGGCCAATTGGCAAGTGGCGGAAACGATAATAAGCTCATTGTCTGGGATAGA
CTCTCAGAAACACCCTTATGGAAATTTTCGGAACATACCGCCGCCGTTAAGGCTATATCTTGGTCTCCCCACCAA
CGCGGATTACTGTCGTCGGGGGGCGGTACGGCCGATCGAAGAATTATTTTTCACGATACCGTCAGGGGCTCCGTC
ATCAACGAGATAGATACGGGCAGCCAAGTCTGCAATATTGCATGGTCTCGAAACACTAACGAAATAGTTTCGACA
CATGGCTATAGCCAGAATCAAATCGTGGTGTGGAAGTACCCGTCGATGACCCAGGTGGCTAGCTTGACGGGCCAT
ACTTACCGCGTTCTCTACCTGGCTATGAGTCCAGACGGCCGCATCGTCGTGACAGGTGCTGGCGACGAGACGCTC
CGATTCTGGTCCGTGTTCGGCCGCCGGCCTGGAACGAGGGAAGAAGGCGAAAGTGGAGGCGGAAGACTGGCTGAC
TGGAGCATCATTCGATAA
Transcript >OphauG2|241
ATGAGAAGCCAACCAAAATCCCCGACTCTGTCGAATCCAATGTCTGTATCAGCCGGCAAGGCTGTTGACGATTCC
CAAGCTATTCTACCATCCGACACGCCCCGACCCTCTACGCCTCCACCCCAGTTATTGCGGGAACGTCCTGCAACC
GATCGCTTGAGCGTACGGTATGGGAAAGTGGTCGCCCCTGGCACCCCTGCTCCCCAGGACATTACGGATTGCACC
CATGGCATGGAACGCGTTCCATCCAAGGGGTCTCAACGCGATCACGAGGCCGTTGATGTCGGCACTGTCGATGGA
AAACACCTAAGAGAGCTACAGCGCACCCTTTGCGAGAGTCCGCCAAACGCCAGTCCTCATCGTAAAAGGCAGCGA
ATAAATGGCGATCGTTTTATCCCCTCGCGGTCTGGCCAAGACTTGCAAGCTAGCTTCTCTCTTCTCCATGAGGAC
GCTTCTCCCGCATCACCGTCAAAACAAAAGAAGCGGACCCCCCATGGAGAATTGCACTTCCAGAAGACCGAAGAG
GCAAACCGTACCTTTTCAACACTGCTCCGCGCCGAGCTCTTCGAAAGCTCAGTCCCTCATGCCTCCTCACGTACA
GCATATCCGTCTGGAAATGTCTTACCCAACTTCGCTCAGGTTTCTGCCAATGATGGCACACGAGCTACAACACCC
CCTGGTAGCAATGCGGCCACGTCTCTGCCCTCGTCGTTGACGCCATCAACTCCCCATAAAAACCTCTTTACTTAC
ATGTCTCCTCATCAACAACAAAGCATAGCCGGTCACCCGACCCCAACAAAGACGCCACAAAGCCGTCACGGCCCC
AGCTTGGATGCACGTGCCGAGATCTACAGCTTGTCCCCCGTTCGTCTGGGCAGTCAACAGTTGCTCTTGAGCCCA
CGCCGGCAGTCTCGAGCCGTGAGCAAGGTGCCCTACAAAGTTCTTGACGCCCCCGAGCTAGCAGATGACTTCTAC
CTGAACCTTGTCGACTGGGGTAGTGCCAACGTTCTTGGCGTTGGACTTGGGTCCAGTGTGTACATGTGGAATGCA
CAGACCAGTAAAGTTAACAAACTCTGCACACTCGAGGACGACACGGTGACAAGTGTTTCATGGATTCAAAAGGGC
ACGCATCTTGCCATCGGTACCGGCAAGGGCCTCGTTCAAATTTGGGATGCTGAAAAAACACGAAGGTTGCGCACC
ATGACGGGCCATACAGCTCGTGTTGGGTCGCTTGCCTGGAACTCGCATGTCCTGACATCTGGCTCACGTGACAGG
CTCATCTATCATAGAGATGTGCGCTCCTCGGATCAGTGGATGAAGAAGCTTGTTGGACACAAACAAGAGGTTTGC
GGACTAAAATGGAATTGCGAAGATGGCCAATTGGCAAGTGGCGGAAACGATAATAAGCTCATTGTCTGGGATAGA
CTCTCAGAAACACCCTTATGGAAATTTTCGGAACATACCGCCGCCGTTAAGGCTATATCTTGGTCTCCCCACCAA
CGCGGATTACTGTCGTCGGGGGGCGGTACGGCCGATCGAAGAATTATTTTTCACGATACCGTCAGGGGCTCCGTC
ATCAACGAGATAGATACGGGCAGCCAAGTCTGCAATATTGCATGGTCTCGAAACACTAACGAAATAGTTTCGACA
CATGGCTATAGCCAGAATCAAATCGTGGTGTGGAAGTACCCGTCGATGACCCAGGTGGCTAGCTTGACGGGCCAT
ACTTACCGCGTTCTCTACCTGGCTATGAGTCCAGACGGCCGCATCGTCGTGACAGGTGCTGGCGACGAGACGCTC
CGATTCTGGTCCGTGTTCGGCCGCCGGCCTGGAACGAGGGAAGAAGGCGAAAGTGGAGGCGGAAGACTGGCTGAC
TGGAGCATCATTCGATAA
Gene >OphauG2|241
ATGAGAAGCCAACCAAAATCCCCGACTCTGTCGAATCCAATGTCTGTATCAGCCGGCAAGGCTGTTGACGATTCC
CAAGCTATTCTACCATCCGACACGCCCCGACCCTCTACGCCTCCACCCCAGTTATTGCGGGAACGTCCTGCAACC
GATCGCTTGAGCGTACGGTATGGGAAAGTGGTCGCCCCTGGCACCCCTGCTCCCCAGGACATTACGGATTGCACC
CATGGCATGGAACGCGTTCCATCCAAGGGGTCTCAACGCGATCACGAGGCCGTTGATGTCGGCACTGTCGATGGA
AAACACCTAAGAGAGCTACAGCGCACCCTTTGCGAGAGTCCGCCAAACGCCAGTCCTCATCGTAAAAGGCAGCGA
ATAAATGGCGATCGGTGAGCCTCATCACGACACTTGTTGCCAGTCTGCTCAACGTATACTTTCTGACGGTACATA
GTTTTATCCCCTCGCGGTCTGGCCAAGACTTGCAAGCTAGCTTCTCTCTTCTCCATGAGGACGCTTCTCCCGCAT
CACCGTCAAAACAAAAGAAGCGGACCCCCCATGGAGAATTGCACTTCCAGAAGAGTCAGTACTTCATACGCCAGC
CTCTCCTCTGGCCCTGTCGATATCCTTGATTGCGAGCCGTGCTAACTATTGCATCGCAAATGAAGCCGAAGAGGC
AAACCGTACCTTTTCAACACTGCTCCGCGCCGAGCTCTTCGAAAGCTCAGTCCCTCATGCCTCCTCACGTACAGC
ATATCCGTCTGGAAATGTCTTACCCAACTTCGCTCAGGTTTCTGCCAATGATGGCACACGAGCTACAACACCCCC
TGGTAGCAATGCGGCCACGTCTCTGCCCTCGTCGTTGACGCCATCAACTCCCCATAAAAACCTCTTTACTTACAT
GTCTCCTCATCAACAACAAAGCATAGCCGGTCACCCGACCCCAACAAAGACGCCACAAAGCCGTCACGGCCCCAG
CTTGGATGCACGTGCCGAGATCTACAGCTTGTCCCCCGTTCGTCTGGGCAGTCAACAGTTGCTCTTGAGCCCACG
CCGGCAGTCTCGAGCCGTGAGCAAGGTGCCCTACAAAGTTCTTGACGCCCCCGAGCTAGCAGATGACTTCTACCT
GAACCTTGTCGACTGGGGTAGTGCCAACGTTCTTGGCGTTGGACTTGGGTCCAGTGTGTACATGTGGAATGCACA
GACCAGTAAAGTTAACAAACTCTGCACACTCGAGGACGACACGGTGACAAGTGTTTCATGGATTCAAAAGGGCAC
GCATCTTGCCATCGGTACCGGCAAGGGCCTCGTTCAAATTTGGGATGCTGAAAAAACACGAAGGTTGCGCACCAT
GACGGGCCATACAGCTCGTGTTGGGTCGCTTGCCTGGAACTCGCATGTCCTGACATCTGGCTCACGTGACAGGCT
CATCTATCATAGAGATGTGCGCTCCTCGGATCAGTGGATGAAGAAGCTTGTTGGACACAAACAAGAGGTTTGCGG
ACTAAAATGGAATTGCGAAGATGGCCAATTGGCAAGTGGCGGAAACGATAATAAGCTCATTGTCTGGGATAGACT
CTCAGAAACACCCTTATGGAAATTTTCGGAACATACCGCCGCCGTTAAGGCTATATCTTGGTCTCCCCACCAACG
CGGATTACTGTCGTCGGGGGGCGGTACGGCCGATCGAAGAATTATTTTTCACGATACCGTCAGGGGCTCCGTCAT
CAACGAGATAGATACGGGCAGCCAAGTCTGCAATATTGCATGGTCTCGAAACACTAACGAAATAGTTTCGACACA
TGGCTATAGCCAGAATCAAATCGTGGTGTGGAAGTACCCGTCGATGACCCAGGTGGCTAGCTTGACGGGCCATAC
TTACCGCGTTCTCTACCTGGCTATGAGTCCAGACGGCCGCATCGTCGTGACAGGTGCTGGCGACGAGACGCTCCG
ATTCTGGTCCGTGTTCGGCCGCCGGCCTGGAACGAGGGAAGAAGGCGAAAGTGGAGGCGGAAGACTGGCTGACTG
GAGCATCATTCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail