Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2407
Gene name
LocationContig_187:534..1395
Strand+
Gene length (bp)861
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit 8.6E-21 91 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O47950|NDUS7_NEUCR NADH-ubiquinone oxidoreductase 19.3 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=G17A4.170 PE=2 SV=1 1 216 1.0E-122
sp|P42026|NDUS7_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Bos taurus GN=NDUFS7 PE=1 SV=1 32 216 1.0E-96
sp|P0CB84|NDUS7_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Pongo pygmaeus GN=NDUFS7 PE=2 SV=1 11 216 1.0E-95
sp|Q0MQH9|NDUS7_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS7 PE=2 SV=1 11 216 1.0E-95
sp|Q0MQI0|NDUS7_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Pan troglodytes GN=NDUFS7 PE=2 SV=1 11 216 1.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O47950|NDUS7_NEUCR NADH-ubiquinone oxidoreductase 19.3 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=G17A4.170 PE=2 SV=1 1 216 1.0E-122
sp|P42026|NDUS7_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Bos taurus GN=NDUFS7 PE=1 SV=1 32 216 1.0E-96
sp|P0CB84|NDUS7_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Pongo pygmaeus GN=NDUFS7 PE=2 SV=1 11 216 1.0E-95
sp|Q0MQH9|NDUS7_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS7 PE=2 SV=1 11 216 1.0E-95
sp|Q0MQI0|NDUS7_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Pan troglodytes GN=NDUFS7 PE=2 SV=1 11 216 1.0E-95
sp|O75251|NDUS7_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Homo sapiens GN=NDUFS7 PE=1 SV=3 34 216 1.0E-95
sp|P0CB83|NDUS7_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Pongo abelii GN=NDUFS7 PE=2 SV=1 34 216 2.0E-95
sp|Q9DC70|NDUS7_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Mus musculus GN=Ndufs7 PE=1 SV=1 64 216 9.0E-95
sp|Q43844|NDUS7_SOLTU NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Solanum tuberosum PE=2 SV=1 1 214 2.0E-89
sp|P42027|NDUS7_BRAOL NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Brassica oleracea PE=2 SV=1 1 216 5.0E-89
sp|O21272|NDUS7_RECAM NADH-ubiquinone oxidoreductase 20 kDa subunit OS=Reclinomonas americana GN=NAD10 PE=3 SV=1 43 216 3.0E-88
sp|A8XFG2|NDUS7_CAEBR Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Caenorhabditis briggsae GN=nduf-7 PE=3 SV=1 11 216 1.0E-87
sp|Q94360|NDUS7_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Caenorhabditis elegans GN=nduf-7 PE=3 SV=1 11 216 3.0E-87
sp|Q42577|NDUS7_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Arabidopsis thaliana GN=At5g11770 PE=2 SV=1 14 216 4.0E-87
sp|Q2W3I5|NUOB_MAGSA NADH-quinone oxidoreductase subunit B OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=nuoB PE=3 SV=1 53 207 1.0E-86
sp|B5EN70|NUOB2_ACIF5 NADH-quinone oxidoreductase subunit B 2 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=nuoB2 PE=3 SV=1 58 208 2.0E-86
sp|B7J6H2|NUOB_ACIF2 NADH-quinone oxidoreductase subunit B OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=nuoB PE=3 SV=1 58 208 2.0E-86
sp|B5EM21|NUOB1_ACIF5 NADH-quinone oxidoreductase subunit B 1 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=nuoB1 PE=3 SV=1 58 208 2.0E-86
sp|Q0BSK3|NUOB_GRABC NADH-quinone oxidoreductase subunit B OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=nuoB PE=3 SV=1 47 207 2.0E-86
sp|B8GNY6|NUOB_THISH NADH-quinone oxidoreductase subunit B OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=nuoB PE=3 SV=1 58 208 2.0E-86
sp|Q31HF9|NUOB_THICR NADH-quinone oxidoreductase subunit B OS=Thiomicrospira crunogena (strain XCL-2) GN=nuoB PE=3 SV=1 58 208 3.0E-86
sp|A1WXW6|NUOB_HALHL NADH-quinone oxidoreductase subunit B OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=nuoB PE=3 SV=1 58 208 8.0E-86
sp|Q3J829|NUOB2_NITOC NADH-quinone oxidoreductase subunit B 2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nuoB2 PE=3 SV=1 58 211 8.0E-86
sp|A5IHW2|NUOB_LEGPC NADH-quinone oxidoreductase subunit B OS=Legionella pneumophila (strain Corby) GN=nuoB PE=3 SV=1 65 209 2.0E-85
sp|A9HRU3|NUOB2_GLUDA NADH-quinone oxidoreductase subunit B 2 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=nuoB2 PE=3 SV=1 65 207 2.0E-85
sp|A1AVR3|NUOB_RUTMC NADH-quinone oxidoreductase subunit B OS=Ruthia magnifica subsp. Calyptogena magnifica GN=nuoB PE=3 SV=1 65 208 2.0E-85
sp|Q5WT21|NUOB_LEGPL NADH-quinone oxidoreductase subunit B OS=Legionella pneumophila (strain Lens) GN=nuoB PE=3 SV=1 65 209 2.0E-85
sp|Q5ZRT9|NUOB_LEGPH NADH-quinone oxidoreductase subunit B OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=nuoB PE=3 SV=1 65 209 2.0E-85
sp|Q5X1A8|NUOB_LEGPA NADH-quinone oxidoreductase subunit B OS=Legionella pneumophila (strain Paris) GN=nuoB PE=3 SV=1 65 209 2.0E-85
sp|Q0A776|NUOB_ALKEH NADH-quinone oxidoreductase subunit B OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=nuoB PE=3 SV=1 58 208 3.0E-85
sp|Q87EQ4|NUOB_XYLFT NADH-quinone oxidoreductase subunit B OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=nuoB PE=3 SV=2 37 208 5.0E-85
sp|B2I785|NUOB_XYLF2 NADH-quinone oxidoreductase subunit B OS=Xylella fastidiosa (strain M23) GN=nuoB PE=3 SV=1 37 208 5.0E-85
sp|Q3BRN0|NUOB_XANC5 NADH-quinone oxidoreductase subunit B OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=nuoB PE=3 SV=1 29 208 5.0E-85
sp|Q8PJ41|NUOB_XANAC NADH-quinone oxidoreductase subunit B OS=Xanthomonas axonopodis pv. citri (strain 306) GN=nuoB PE=3 SV=2 29 208 5.0E-85
sp|Q8P7T3|NUOB_XANCP NADH-quinone oxidoreductase subunit B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=nuoB PE=3 SV=2 37 208 7.0E-85
sp|B0RR99|NUOB_XANCB NADH-quinone oxidoreductase subunit B OS=Xanthomonas campestris pv. campestris (strain B100) GN=nuoB PE=3 SV=2 37 208 7.0E-85
sp|Q4UWB7|NUOB_XANC8 NADH-quinone oxidoreductase subunit B OS=Xanthomonas campestris pv. campestris (strain 8004) GN=nuoB PE=3 SV=2 37 208 7.0E-85
sp|Q2GG48|NUOB_EHRCR NADH-quinone oxidoreductase subunit B OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=nuoB PE=3 SV=1 70 211 7.0E-85
sp|Q5GXT2|NUOB_XANOR NADH-quinone oxidoreductase subunit B OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=nuoB PE=3 SV=2 37 208 8.0E-85
sp|Q2P0V6|NUOB_XANOM NADH-quinone oxidoreductase subunit B OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=nuoB PE=3 SV=2 37 208 8.0E-85
sp|B2SVL8|NUOB_XANOP NADH-quinone oxidoreductase subunit B OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=nuoB PE=3 SV=1 37 208 9.0E-85
sp|Q82TU4|NUOB_NITEU NADH-quinone oxidoreductase subunit B OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=nuoB PE=3 SV=1 58 208 1.0E-84
sp|Q2RU39|NUOB_RHORT NADH-quinone oxidoreductase subunit B OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=nuoB PE=3 SV=1 40 207 1.0E-84
sp|A5FX09|NUOB1_ACICJ NADH-quinone oxidoreductase subunit B 1 OS=Acidiphilium cryptum (strain JF-5) GN=nuoB1 PE=3 SV=1 53 207 1.0E-84
sp|A5CXF8|NUOB_VESOH NADH-quinone oxidoreductase subunit B OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=nuoB PE=3 SV=1 60 208 2.0E-84
sp|Q9PGJ4|NUOB_XYLFA NADH-quinone oxidoreductase subunit B OS=Xylella fastidiosa (strain 9a5c) GN=nuoB PE=3 SV=2 37 208 2.0E-84
sp|Q1GZL0|NUOB_METFK NADH-quinone oxidoreductase subunit B OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=nuoB PE=3 SV=1 60 208 2.0E-84
sp|B0U1W6|NUOB_XYLFM NADH-quinone oxidoreductase subunit B OS=Xylella fastidiosa (strain M12) GN=nuoB PE=3 SV=1 37 208 2.0E-84
sp|Q2YA26|NUOB2_NITMU NADH-quinone oxidoreductase subunit B 2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoB2 PE=3 SV=1 59 208 2.0E-84
sp|C1DCA4|NUOB_LARHH NADH-quinone oxidoreductase subunit B OS=Laribacter hongkongensis (strain HLHK9) GN=nuoB PE=3 SV=1 58 207 3.0E-84
sp|C5CT19|NUOB_VARPS NADH-quinone oxidoreductase subunit B OS=Variovorax paradoxus (strain S110) GN=nuoB PE=3 SV=1 60 208 3.0E-84
sp|Q47HH5|NUOB_DECAR NADH-quinone oxidoreductase subunit B OS=Dechloromonas aromatica (strain RCB) GN=nuoB PE=3 SV=1 60 208 4.0E-84
sp|B3R3W8|NUOB_CUPTR NADH-quinone oxidoreductase subunit B OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=nuoB PE=3 SV=1 60 208 4.0E-84
sp|Q0KCS9|NUOB_CUPNH NADH-quinone oxidoreductase subunit B OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=nuoB PE=3 SV=1 60 208 4.0E-84
sp|Q1LPW2|NUOB_CUPMC NADH-quinone oxidoreductase subunit B OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nuoB PE=3 SV=1 60 208 4.0E-84
sp|Q5P1E9|NUOB_AROAE NADH-quinone oxidoreductase subunit B OS=Aromatoleum aromaticum (strain EbN1) GN=nuoB PE=3 SV=1 65 208 5.0E-84
sp|A1K5A9|NUOB1_AZOSB NADH-quinone oxidoreductase subunit B 1 OS=Azoarcus sp. (strain BH72) GN=nuoB1 PE=3 SV=1 65 208 5.0E-84
sp|A4G643|NUOB_HERAR NADH-quinone oxidoreductase subunit B OS=Herminiimonas arsenicoxydans GN=nuoB PE=3 SV=1 60 208 5.0E-84
sp|B2U7R0|NUOB_RALPJ NADH-quinone oxidoreductase subunit B OS=Ralstonia pickettii (strain 12J) GN=nuoB PE=3 SV=1 60 208 6.0E-84
sp|Q5LPR4|NUOB_RUEPO NADH-quinone oxidoreductase subunit B OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=nuoB PE=3 SV=2 49 207 9.0E-84
sp|A6SY06|NUOB_JANMA NADH-quinone oxidoreductase subunit B OS=Janthinobacterium sp. (strain Marseille) GN=nuoB PE=3 SV=1 60 208 9.0E-84
sp|Q8XXQ2|NUOB_RALSO NADH-quinone oxidoreductase subunit B OS=Ralstonia solanacearum (strain GMI1000) GN=nuoB PE=3 SV=1 60 208 9.0E-84
sp|Q142H2|NUOB_BURXL NADH-quinone oxidoreductase subunit B OS=Burkholderia xenovorans (strain LB400) GN=nuoB PE=3 SV=1 60 208 9.0E-84
sp|B2T2E8|NUOB_BURPP NADH-quinone oxidoreductase subunit B OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=nuoB PE=3 SV=1 60 208 9.0E-84
sp|B2JDM7|NUOB_BURP8 NADH-quinone oxidoreductase subunit B OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=nuoB PE=3 SV=1 60 208 9.0E-84
sp|Q473U2|NUOB_CUPPJ NADH-quinone oxidoreductase subunit B OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nuoB PE=3 SV=1 60 208 1.0E-83
sp|A1VM61|NUOB_POLNA NADH-quinone oxidoreductase subunit B OS=Polaromonas naphthalenivorans (strain CJ2) GN=nuoB PE=3 SV=1 60 208 1.0E-83
sp|Q1GIP1|NUOB_RUEST NADH-quinone oxidoreductase subunit B OS=Ruegeria sp. (strain TM1040) GN=nuoB PE=3 SV=1 53 207 1.0E-83
sp|B2FNX8|NUOB_STRMK NADH-quinone oxidoreductase subunit B OS=Stenotrophomonas maltophilia (strain K279a) GN=nuoB PE=3 SV=1 29 208 1.0E-83
sp|B4SQT5|NUOB_STRM5 NADH-quinone oxidoreductase subunit B OS=Stenotrophomonas maltophilia (strain R551-3) GN=nuoB PE=3 SV=1 29 208 1.0E-83
sp|Q2SZN4|NUOB_BURTA NADH-quinone oxidoreductase subunit B OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nuoB PE=3 SV=2 60 207 1.0E-83
sp|Q63VN2|NUOB1_BURPS NADH-quinone oxidoreductase subunit B 1 OS=Burkholderia pseudomallei (strain K96243) GN=nuoB1 PE=3 SV=2 60 207 1.0E-83
sp|A3N7L8|NUOB1_BURP6 NADH-quinone oxidoreductase subunit B 1 OS=Burkholderia pseudomallei (strain 668) GN=nuoB1 PE=3 SV=1 60 207 1.0E-83
sp|Q3JUA8|NUOB1_BURP1 NADH-quinone oxidoreductase subunit B 1 OS=Burkholderia pseudomallei (strain 1710b) GN=nuoB1 PE=3 SV=2 60 207 1.0E-83
sp|A3NTA7|NUOB1_BURP0 NADH-quinone oxidoreductase subunit B 1 OS=Burkholderia pseudomallei (strain 1106a) GN=nuoB1 PE=3 SV=1 60 207 1.0E-83
sp|A1V2L7|NUOB1_BURMS NADH-quinone oxidoreductase subunit B 1 OS=Burkholderia mallei (strain SAVP1) GN=nuoB1 PE=3 SV=1 60 207 1.0E-83
sp|Q62IN6|NUOB1_BURMA NADH-quinone oxidoreductase subunit B 1 OS=Burkholderia mallei (strain ATCC 23344) GN=nuoB1 PE=3 SV=2 60 207 1.0E-83
sp|A2S458|NUOB1_BURM9 NADH-quinone oxidoreductase subunit B 1 OS=Burkholderia mallei (strain NCTC 10229) GN=nuoB1 PE=3 SV=1 60 207 1.0E-83
sp|A3MIA2|NUOB1_BURM7 NADH-quinone oxidoreductase subunit B 1 OS=Burkholderia mallei (strain NCTC 10247) GN=nuoB1 PE=3 SV=1 60 207 1.0E-83
sp|B1Y828|NUOB_LEPCP NADH-quinone oxidoreductase subunit B OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=nuoB PE=3 SV=1 58 205 1.0E-83
sp|A4JGC9|NUOB_BURVG NADH-quinone oxidoreductase subunit B OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=nuoB PE=3 SV=1 60 208 2.0E-83
sp|A9AFY8|NUOB_BURM1 NADH-quinone oxidoreductase subunit B OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=nuoB PE=3 SV=1 60 208 2.0E-83
sp|Q39EE6|NUOB_BURL3 NADH-quinone oxidoreductase subunit B OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nuoB PE=3 SV=1 60 208 2.0E-83
sp|Q0BDD1|NUOB_BURCM NADH-quinone oxidoreductase subunit B OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=nuoB PE=3 SV=1 60 208 2.0E-83
sp|B4E5M1|NUOB_BURCJ NADH-quinone oxidoreductase subunit B OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=nuoB PE=3 SV=2 60 208 2.0E-83
sp|A0K922|NUOB_BURCH NADH-quinone oxidoreductase subunit B OS=Burkholderia cenocepacia (strain HI2424) GN=nuoB PE=3 SV=1 60 208 2.0E-83
sp|B1JVP0|NUOB_BURCC NADH-quinone oxidoreductase subunit B OS=Burkholderia cenocepacia (strain MC0-3) GN=nuoB PE=3 SV=1 60 208 2.0E-83
sp|Q1BV14|NUOB_BURCA NADH-quinone oxidoreductase subunit B OS=Burkholderia cenocepacia (strain AU 1054) GN=nuoB PE=3 SV=1 60 208 2.0E-83
sp|B1YTQ6|NUOB_BURA4 NADH-quinone oxidoreductase subunit B OS=Burkholderia ambifaria (strain MC40-6) GN=nuoB PE=3 SV=1 60 208 2.0E-83
sp|Q127X3|NUOB_POLSJ NADH-quinone oxidoreductase subunit B OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=nuoB PE=3 SV=1 65 208 3.0E-83
sp|Q7NZI0|NUOB1_CHRVO NADH-quinone oxidoreductase subunit B 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nuoB1 PE=3 SV=1 58 208 3.0E-83
sp|A0LDS6|NUOB_MAGMM NADH-quinone oxidoreductase subunit B OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=nuoB PE=3 SV=1 65 216 3.0E-83
sp|A8LIT6|NUOB_DINSH NADH-quinone oxidoreductase subunit B OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=nuoB PE=3 SV=1 53 207 4.0E-83
sp|A6X1N3|NUOB_OCHA4 NADH-quinone oxidoreductase subunit B OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=nuoB PE=3 SV=1 43 207 4.0E-83
sp|Q28T75|NUOB_JANSC NADH-quinone oxidoreductase subunit B OS=Jannaschia sp. (strain CCS1) GN=nuoB PE=3 SV=1 65 207 5.0E-83
sp|Q1RJI6|NUOB_RICBR NADH-quinone oxidoreductase subunit B OS=Rickettsia bellii (strain RML369-C) GN=nuoB PE=3 SV=1 53 207 5.0E-83
sp|A4SXQ2|NUOB_POLSQ NADH-quinone oxidoreductase subunit B OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=nuoB PE=3 SV=1 60 211 7.0E-83
sp|B1XUJ9|NUOB_POLNS NADH-quinone oxidoreductase subunit B OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=nuoB PE=3 SV=1 60 211 7.0E-83
sp|A9II02|NUOB_BORPD NADH-quinone oxidoreductase subunit B OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=nuoB PE=3 SV=2 65 208 8.0E-83
sp|Q8G1B6|NUOB_BRUSU NADH-quinone oxidoreductase subunit B OS=Brucella suis biovar 1 (strain 1330) GN=nuoB PE=3 SV=1 43 207 9.0E-83
sp|B0CLD0|NUOB_BRUSI NADH-quinone oxidoreductase subunit B OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=nuoB PE=3 SV=1 43 207 9.0E-83
sp|A5VPY4|NUOB_BRUO2 NADH-quinone oxidoreductase subunit B OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=nuoB PE=3 SV=1 43 207 9.0E-83
sp|Q8YGK1|NUOB_BRUME NADH-quinone oxidoreductase subunit B OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=nuoB PE=3 SV=2 43 207 9.0E-83
sp|C0RIE0|NUOB_BRUMB NADH-quinone oxidoreductase subunit B OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=nuoB PE=3 SV=1 43 207 9.0E-83
sp|A9MAI0|NUOB_BRUC2 NADH-quinone oxidoreductase subunit B OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=nuoB PE=3 SV=1 43 207 9.0E-83
sp|A2SFM7|NUOB_METPP NADH-quinone oxidoreductase subunit B OS=Methylibium petroleiphilum (strain PM1) GN=nuoB PE=3 SV=1 58 205 9.0E-83
sp|Q0AHJ9|NUOB_NITEC NADH-quinone oxidoreductase subunit B OS=Nitrosomonas eutropha (strain C91) GN=nuoB PE=3 SV=1 58 211 1.0E-82
sp|A8GRR7|NUOB_RICRS NADH-quinone oxidoreductase subunit B OS=Rickettsia rickettsii (strain Sheila Smith) GN=nuoB PE=3 SV=1 53 207 1.0E-82
sp|B0BX73|NUOB_RICRO NADH-quinone oxidoreductase subunit B OS=Rickettsia rickettsii (strain Iowa) GN=nuoB PE=3 SV=1 53 207 1.0E-82
sp|C4K2P3|NUOB_RICPU NADH-quinone oxidoreductase subunit B OS=Rickettsia peacockii (strain Rustic) GN=nuoB PE=3 SV=1 53 207 1.0E-82
sp|Q92ID6|NUOB_RICCN NADH-quinone oxidoreductase subunit B OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoB PE=3 SV=1 53 207 1.0E-82
sp|Q2GDX9|NUOB_NEOSM NADH-quinone oxidoreductase subunit B OS=Neorickettsia sennetsu (strain Miyayama) GN=nuoB PE=3 SV=1 65 208 1.0E-82
sp|A8F1C7|NUOB_RICM5 NADH-quinone oxidoreductase subunit B OS=Rickettsia massiliae (strain Mtu5) GN=nuoB PE=3 SV=1 53 207 1.0E-82
sp|C3PN71|NUOB_RICAE NADH-quinone oxidoreductase subunit B OS=Rickettsia africae (strain ESF-5) GN=nuoB PE=3 SV=1 53 207 1.0E-82
sp|Q3J3G0|NUOB1_RHOS4 NADH-quinone oxidoreductase subunit B 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoB1 PE=3 SV=2 65 211 2.0E-82
sp|A3PIW9|NUOB1_RHOS1 NADH-quinone oxidoreductase subunit B 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoB1 PE=3 SV=1 65 211 2.0E-82
sp|A1W4M3|NUOB_ACISJ NADH-quinone oxidoreductase subunit B OS=Acidovorax sp. (strain JS42) GN=nuoB PE=3 SV=1 60 207 2.0E-82
sp|B9MEL5|NUOB_ACIET NADH-quinone oxidoreductase subunit B OS=Acidovorax ebreus (strain TPSY) GN=nuoB PE=3 SV=1 60 207 2.0E-82
sp|A8GX77|NUOB_RICB8 NADH-quinone oxidoreductase subunit B OS=Rickettsia bellii (strain OSU 85-389) GN=nuoB PE=3 SV=1 53 207 2.0E-82
sp|B9KQW1|NUOB1_RHOSK NADH-quinone oxidoreductase subunit B 1 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=nuoB1 PE=3 SV=1 65 211 2.0E-82
sp|Q4UM06|NUOB_RICFE NADH-quinone oxidoreductase subunit B OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoB PE=3 SV=1 53 207 2.0E-82
sp|A8EZ83|NUOB_RICCK NADH-quinone oxidoreductase subunit B OS=Rickettsia canadensis (strain McKiel) GN=nuoB PE=3 SV=1 65 207 3.0E-82
sp|Q2KV17|NUOB_BORA1 NADH-quinone oxidoreductase subunit B OS=Bordetella avium (strain 197N) GN=nuoB PE=3 SV=1 65 208 3.0E-82
sp|A1TLL7|NUOB_ACIAC NADH-quinone oxidoreductase subunit B OS=Acidovorax citrulli (strain AAC00-1) GN=nuoB PE=3 SV=1 60 208 3.0E-82
sp|Q7VZQ4|NUOB_BORPE NADH-quinone oxidoreductase subunit B OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=nuoB PE=3 SV=1 65 208 3.0E-82
sp|Q7W5A8|NUOB_BORPA NADH-quinone oxidoreductase subunit B OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=nuoB PE=3 SV=1 65 208 3.0E-82
sp|Q7WCU0|NUOB_BORBR NADH-quinone oxidoreductase subunit B OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=nuoB PE=3 SV=1 65 208 3.0E-82
sp|B5ZYL3|NUOB_RHILW NADH-quinone oxidoreductase subunit B OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=nuoB PE=3 SV=1 43 207 5.0E-82
sp|Q57DV0|NUOB_BRUAB NADH-quinone oxidoreductase subunit B OS=Brucella abortus biovar 1 (strain 9-941) GN=nuoB PE=3 SV=1 53 207 6.0E-82
sp|Q2YNC8|NUOB_BRUA2 NADH-quinone oxidoreductase subunit B OS=Brucella abortus (strain 2308) GN=nuoB PE=3 SV=1 53 207 6.0E-82
sp|B2S544|NUOB_BRUA1 NADH-quinone oxidoreductase subunit B OS=Brucella abortus (strain S19) GN=nuoB PE=3 SV=1 53 207 6.0E-82
sp|B3PVZ8|NUOB1_RHIE6 NADH-quinone oxidoreductase subunit B 1 OS=Rhizobium etli (strain CIAT 652) GN=nuoB1 PE=3 SV=1 43 207 7.0E-82
sp|Q163Q1|NUOB_ROSDO NADH-quinone oxidoreductase subunit B OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=nuoB PE=3 SV=1 65 207 7.0E-82
sp|Q68X17|NUOB_RICTY NADH-quinone oxidoreductase subunit B OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoB PE=3 SV=1 65 207 7.0E-82
sp|Q2K9T4|NUOB1_RHIEC NADH-quinone oxidoreductase subunit B 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoB1 PE=3 SV=1 43 207 8.0E-82
sp|A4WU33|NUOB2_RHOS5 NADH-quinone oxidoreductase subunit B 2 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=nuoB2 PE=3 SV=1 65 211 8.0E-82
sp|Q11JK5|NUOB_CHESB NADH-quinone oxidoreductase subunit B OS=Chelativorans sp. (strain BNC1) GN=nuoB PE=3 SV=1 41 207 8.0E-82
sp|Q9ZDH2|NUOB_RICPR NADH-quinone oxidoreductase subunit B OS=Rickettsia prowazekii (strain Madrid E) GN=nuoB PE=3 SV=1 65 207 9.0E-82
sp|O68853|NUOB1_RHIME NADH-quinone oxidoreductase subunit B 1 OS=Rhizobium meliloti (strain 1021) GN=nuoB1 PE=3 SV=2 43 207 1.0E-81
sp|B3CM42|NUOB_WOLPP NADH-quinone oxidoreductase subunit B OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=nuoB PE=3 SV=1 70 208 1.0E-81
sp|A9BNB3|NUOB_DELAS NADH-quinone oxidoreductase subunit B OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=nuoB PE=3 SV=1 60 208 1.0E-81
sp|Q3SEX7|NUOB_THIDA NADH-quinone oxidoreductase subunit B OS=Thiobacillus denitrificans (strain ATCC 25259) GN=nuoB PE=3 SV=1 60 208 1.0E-81
sp|Q1MIL4|NUOB_RHIL3 NADH-quinone oxidoreductase subunit B OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nuoB PE=3 SV=1 43 207 1.0E-81
sp|O84970|NUOB_RHOCA NADH-quinone oxidoreductase subunit B OS=Rhodobacter capsulatus GN=nuoB PE=3 SV=1 65 207 2.0E-81
sp|A7HY48|NUOB_PARL1 NADH-quinone oxidoreductase subunit B OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=nuoB PE=3 SV=1 35 207 2.0E-81
sp|A1B497|NUOB_PARDP NADH-quinone oxidoreductase subunit B OS=Paracoccus denitrificans (strain Pd 1222) GN=nuoB PE=1 SV=1 42 207 2.0E-81
sp|A8GN54|NUOB_RICAH NADH-quinone oxidoreductase subunit B OS=Rickettsia akari (strain Hartford) GN=nuoB PE=3 SV=1 53 207 3.0E-81
sp|A4IVZ3|NUOB_FRATW NADH-quinone oxidoreductase subunit B OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=nuoB PE=3 SV=1 65 211 3.0E-81
sp|Q5NIN4|NUOB_FRATT NADH-quinone oxidoreductase subunit B OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=nuoB PE=3 SV=1 65 211 3.0E-81
sp|Q0BK52|NUOB_FRATO NADH-quinone oxidoreductase subunit B OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=nuoB PE=3 SV=1 65 211 3.0E-81
sp|A0Q8H1|NUOB_FRATN NADH-quinone oxidoreductase subunit B OS=Francisella tularensis subsp. novicida (strain U112) GN=nuoB PE=3 SV=1 65 211 3.0E-81
sp|B2SEV0|NUOB_FRATM NADH-quinone oxidoreductase subunit B OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=nuoB PE=3 SV=1 65 211 3.0E-81
sp|Q2A1F1|NUOB_FRATH NADH-quinone oxidoreductase subunit B OS=Francisella tularensis subsp. holarctica (strain LVS) GN=nuoB PE=3 SV=1 65 211 3.0E-81
sp|A7NEK9|NUOB_FRATF NADH-quinone oxidoreductase subunit B OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=nuoB PE=3 SV=1 65 211 3.0E-81
sp|Q14K37|NUOB_FRAT1 NADH-quinone oxidoreductase subunit B OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=nuoB PE=3 SV=1 65 211 3.0E-81
sp|Q4FM90|NUOB_PELUB NADH-quinone oxidoreductase subunit B OS=Pelagibacter ubique (strain HTCC1062) GN=nuoB PE=3 SV=1 44 206 5.0E-81
sp|Q5HBM2|NUOB_EHRRW NADH-quinone oxidoreductase subunit B OS=Ehrlichia ruminantium (strain Welgevonden) GN=nuoB PE=3 SV=1 70 207 5.0E-81
sp|Q5FHF7|NUOB_EHRRG NADH-quinone oxidoreductase subunit B OS=Ehrlichia ruminantium (strain Gardel) GN=nuoB PE=3 SV=1 70 207 5.0E-81
sp|B3CSG9|NUOB_ORITI NADH-quinone oxidoreductase subunit B OS=Orientia tsutsugamushi (strain Ikeda) GN=nuoB PE=3 SV=1 65 208 5.0E-81
sp|A5CES0|NUOB_ORITB NADH-quinone oxidoreductase subunit B OS=Orientia tsutsugamushi (strain Boryong) GN=nuoB PE=3 SV=1 65 208 5.0E-81
sp|B0TWP5|NUOB_FRAP2 NADH-quinone oxidoreductase subunit B OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=nuoB PE=3 SV=1 65 211 5.0E-81
sp|A1KRS3|NUOB_NEIMF NADH-quinone oxidoreductase subunit B OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=nuoB PE=3 SV=1 58 207 8.0E-81
sp|Q9K1C2|NUOB_NEIMB NADH-quinone oxidoreductase subunit B OS=Neisseria meningitidis serogroup B (strain MC58) GN=nuoB PE=3 SV=1 58 207 8.0E-81
sp|B4RPI3|NUOB_NEIG2 NADH-quinone oxidoreductase subunit B OS=Neisseria gonorrhoeae (strain NCCP11945) GN=nuoB PE=3 SV=1 58 207 8.0E-81
sp|C0R4Y2|NUOB_WOLWR NADH-quinone oxidoreductase subunit B OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=nuoB PE=3 SV=1 71 208 8.0E-81
sp|Q73G42|NUOB_WOLPM NADH-quinone oxidoreductase subunit B OS=Wolbachia pipientis wMel GN=nuoB PE=3 SV=1 71 208 8.0E-81
sp|B9JD43|NUOB_AGRRK NADH-quinone oxidoreductase subunit B OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=nuoB PE=3 SV=1 43 207 8.0E-81
sp|Q5GT43|NUOB_WOLTR NADH-quinone oxidoreductase subunit B OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=nuoB PE=3 SV=1 70 208 8.0E-81
sp|A6U7W4|NUOB_SINMW NADH-quinone oxidoreductase subunit B OS=Sinorhizobium medicae (strain WSM419) GN=nuoB PE=3 SV=1 43 207 1.0E-80
sp|Q1GTJ8|NUOB_SPHAL NADH-quinone oxidoreductase subunit B OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=nuoB PE=3 SV=1 53 207 2.0E-80
sp|A1WLP3|NUOB_VEREI NADH-quinone oxidoreductase subunit B OS=Verminephrobacter eiseniae (strain EF01-2) GN=nuoB PE=3 SV=1 65 207 3.0E-80
sp|Q5F616|NUOB_NEIG1 NADH-quinone oxidoreductase subunit B OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nuoB PE=3 SV=1 58 207 3.0E-80
sp|Q83BQ6|NUOB_COXBU NADH-quinone oxidoreductase subunit B OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=nuoB PE=3 SV=1 65 209 6.0E-80
sp|A9N8X2|NUOB_COXBR NADH-quinone oxidoreductase subunit B OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=nuoB PE=3 SV=1 65 209 6.0E-80
sp|A9KBK5|NUOB_COXBN NADH-quinone oxidoreductase subunit B OS=Coxiella burnetii (strain Dugway 5J108-111) GN=nuoB PE=3 SV=1 65 209 6.0E-80
sp|B6IZ46|NUOB_COXB2 NADH-quinone oxidoreductase subunit B OS=Coxiella burnetii (strain CbuG_Q212) GN=nuoB PE=3 SV=1 65 209 6.0E-80
sp|B6J695|NUOB_COXB1 NADH-quinone oxidoreductase subunit B OS=Coxiella burnetii (strain CbuK_Q154) GN=nuoB PE=3 SV=1 65 209 6.0E-80
sp|Q54NI6|NDUS7_DICDI NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Dictyostelium discoideum GN=ndufs7 PE=3 SV=1 64 216 6.0E-80
sp|A1INN9|NUOB_NEIMA NADH-quinone oxidoreductase subunit B OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nuoB PE=3 SV=1 58 207 8.0E-80
sp|B6JGW0|NUOB_OLICO NADH-quinone oxidoreductase subunit B OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=nuoB PE=3 SV=1 28 205 8.0E-80
sp|B1LUN6|NUOB_METRJ NADH-quinone oxidoreductase subunit B OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=nuoB PE=3 SV=1 43 207 1.0E-79
sp|P29918|NQO6_PARDE NADH-quinone oxidoreductase subunit 6 OS=Paracoccus denitrificans GN=nqo6 PE=3 SV=1 42 203 1.0E-79
sp|Q98KQ6|NUOB_RHILO NADH-quinone oxidoreductase subunit B OS=Rhizobium loti (strain MAFF303099) GN=nuoB PE=3 SV=2 53 207 1.0E-79
sp|A8I3Y7|NUOB_AZOC5 NADH-quinone oxidoreductase subunit B OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nuoB PE=3 SV=1 32 207 2.0E-79
sp|A7IPA6|NUOB_XANP2 NADH-quinone oxidoreductase subunit B OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=nuoB PE=3 SV=1 32 205 3.0E-79
sp|B9KI91|NUOB_ANAMF NADH-quinone oxidoreductase subunit B OS=Anaplasma marginale (strain Florida) GN=nuoB PE=3 SV=1 70 204 3.0E-79
sp|B6ISY0|NUOB_RHOCS NADH-quinone oxidoreductase subunit B OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=nuoB PE=3 SV=1 65 206 3.0E-79
sp|B8EIL8|NUOB_METSB NADH-quinone oxidoreductase subunit B OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=nuoB PE=3 SV=1 44 207 3.0E-79
sp|B8IUU7|NUOB_METNO NADH-quinone oxidoreductase subunit B OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=nuoB PE=3 SV=1 43 207 3.0E-79
sp|Q2G5Y4|NUOB_NOVAD NADH-quinone oxidoreductase subunit B OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=nuoB PE=3 SV=1 53 205 4.0E-79
sp|B1ZA45|NUOB_METPB NADH-quinone oxidoreductase subunit B OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=nuoB PE=3 SV=1 53 207 4.0E-79
sp|Q5PB32|NUOB_ANAMM NADH-quinone oxidoreductase subunit B OS=Anaplasma marginale (strain St. Maries) GN=nuoB PE=3 SV=1 70 204 4.0E-79
sp|Q21YC6|NUOB_RHOFT NADH-quinone oxidoreductase subunit B OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=nuoB PE=3 SV=1 60 208 4.0E-79
sp|B0ULK5|NUOB_METS4 NADH-quinone oxidoreductase subunit B OS=Methylobacterium sp. (strain 4-46) GN=nuoB PE=3 SV=1 43 207 5.0E-79
sp|B2IHW6|NUOB_BEII9 NADH-quinone oxidoreductase subunit B OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=nuoB PE=3 SV=1 65 207 2.0E-78
sp|A5VAL8|NUOB_SPHWW NADH-quinone oxidoreductase subunit B OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=nuoB PE=3 SV=1 53 205 2.0E-78
sp|A9W1N2|NUOB_METEP NADH-quinone oxidoreductase subunit B OS=Methylobacterium extorquens (strain PA1) GN=nuoB PE=3 SV=1 43 205 2.0E-78
sp|B7KQ65|NUOB_METC4 NADH-quinone oxidoreductase subunit B OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=nuoB PE=3 SV=1 43 205 2.0E-78
sp|Q215I4|NUOB1_RHOPB NADH-quinone oxidoreductase subunit B 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=nuoB1 PE=3 SV=1 41 207 2.0E-78
sp|B3Q7N5|NUOB1_RHOPT NADH-quinone oxidoreductase subunit B 1 OS=Rhodopseudomonas palustris (strain TIE-1) GN=nuoB1 PE=3 SV=1 41 207 2.0E-78
sp|Q6N5M3|NUOB1_RHOPA NADH-quinone oxidoreductase subunit B 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=nuoB1 PE=3 SV=1 41 207 2.0E-78
sp|Q2GKI6|NUOB_ANAPZ NADH-quinone oxidoreductase subunit B OS=Anaplasma phagocytophilum (strain HZ) GN=nuoB PE=3 SV=1 70 210 4.0E-78
sp|Q135X5|NUOB2_RHOPS NADH-quinone oxidoreductase subunit B 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoB2 PE=3 SV=1 42 207 4.0E-78
sp|Q2NA61|NUOB_ERYLH NADH-quinone oxidoreductase subunit B OS=Erythrobacter litoralis (strain HTCC2594) GN=nuoB PE=3 SV=2 53 207 4.0E-78
sp|Q0APY9|NUOB_MARMM NADH-quinone oxidoreductase subunit B OS=Maricaulis maris (strain MCS10) GN=nuoB PE=3 SV=1 65 205 5.0E-78
sp|A1USW8|NUOB_BARBK NADH-quinone oxidoreductase subunit B OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=nuoB PE=3 SV=1 53 207 6.0E-78
sp|Q07NM6|NUOB2_RHOP5 NADH-quinone oxidoreductase subunit B 2 OS=Rhodopseudomonas palustris (strain BisA53) GN=nuoB2 PE=3 SV=1 41 205 7.0E-78
sp|Q2K755|NUOB2_RHIEC NADH-quinone oxidoreductase subunit B 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoB2 PE=3 SV=1 31 211 7.0E-78
sp|Q6G389|NUOB_BARHE NADH-quinone oxidoreductase subunit B OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=nuoB PE=3 SV=1 65 207 1.0E-77
sp|Q6FZZ0|NUOB_BARQU NADH-quinone oxidoreductase subunit B OS=Bartonella quintana (strain Toulouse) GN=nuoB PE=3 SV=1 53 207 1.0E-77
sp|Q89KI7|NUOB_BRADU NADH-quinone oxidoreductase subunit B OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nuoB PE=3 SV=1 55 207 2.0E-77
sp|Q0C1E6|NUOB_HYPNA NADH-quinone oxidoreductase subunit B OS=Hyphomonas neptunium (strain ATCC 15444) GN=nuoB PE=3 SV=1 53 205 2.0E-77
sp|Q1QL85|NUOB_NITHX NADH-quinone oxidoreductase subunit B OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=nuoB PE=3 SV=1 65 207 2.0E-77
sp|A9IUQ3|NUOB_BART1 NADH-quinone oxidoreductase subunit B OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=nuoB PE=3 SV=1 53 207 2.0E-77
sp|Q3SRE4|NUOB_NITWN NADH-quinone oxidoreductase subunit B OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=nuoB PE=3 SV=1 65 205 2.0E-77
sp|A4YVL1|NUOB_BRASO NADH-quinone oxidoreductase subunit B OS=Bradyrhizobium sp. (strain ORS278) GN=nuoB PE=3 SV=1 65 207 2.0E-77
sp|A5EK99|NUOB_BRASB NADH-quinone oxidoreductase subunit B OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=nuoB PE=3 SV=1 65 207 3.0E-77
sp|Q63QG0|NUOB2_BURPS NADH-quinone oxidoreductase subunit B 2 OS=Burkholderia pseudomallei (strain K96243) GN=nuoB2 PE=3 SV=1 65 204 6.0E-77
sp|A3NE04|NUOB2_BURP6 NADH-quinone oxidoreductase subunit B 2 OS=Burkholderia pseudomallei (strain 668) GN=nuoB2 PE=3 SV=2 65 204 6.0E-77
sp|A3NZQ8|NUOB2_BURP0 NADH-quinone oxidoreductase subunit B 2 OS=Burkholderia pseudomallei (strain 1106a) GN=nuoB2 PE=3 SV=2 65 204 6.0E-77
sp|A1UWB1|NUOB2_BURMS NADH-quinone oxidoreductase subunit B 2 OS=Burkholderia mallei (strain SAVP1) GN=nuoB2 PE=3 SV=2 65 204 6.0E-77
sp|Q62DE1|NUOB2_BURMA NADH-quinone oxidoreductase subunit B 2 OS=Burkholderia mallei (strain ATCC 23344) GN=nuoB2 PE=3 SV=1 65 204 6.0E-77
sp|A2RYJ4|NUOB2_BURM9 NADH-quinone oxidoreductase subunit B 2 OS=Burkholderia mallei (strain NCTC 10229) GN=nuoB2 PE=3 SV=2 65 204 6.0E-77
sp|A3MFR5|NUOB2_BURM7 NADH-quinone oxidoreductase subunit B 2 OS=Burkholderia mallei (strain NCTC 10247) GN=nuoB2 PE=3 SV=2 65 204 6.0E-77
sp|A9CJB2|NUOB_AGRFC NADH-quinone oxidoreductase subunit B OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=nuoB PE=3 SV=2 43 207 7.0E-76
sp|B9JVE6|NUOB_AGRVS NADH-quinone oxidoreductase subunit B OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=nuoB PE=3 SV=1 43 207 1.0E-75
sp|A1K3P1|NUOB2_AZOSB NADH-quinone oxidoreductase subunit B 2 OS=Azoarcus sp. (strain BH72) GN=nuoB2 PE=3 SV=1 65 205 2.0E-74
sp|Q7NUE5|NUOB2_CHRVO NADH-quinone oxidoreductase subunit B 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nuoB2 PE=3 SV=1 65 205 2.0E-74
sp|B4RCM8|NUOB_PHEZH NADH-quinone oxidoreductase subunit B OS=Phenylobacterium zucineum (strain HLK1) GN=nuoB PE=3 SV=1 65 207 4.0E-74
sp|P15602|NDUS7_PARTE NADH-ubiquinone oxidoreductase 20 kDa subunit OS=Paramecium tetraurelia GN=NAD10 PE=3 SV=1 69 207 2.0E-72
sp|C0Z772|NUOB_BREBN NADH-quinone oxidoreductase subunit B OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=nuoB PE=3 SV=1 52 205 8.0E-69
sp|B0SZ51|NUOB_CAUSK NADH-quinone oxidoreductase subunit B OS=Caulobacter sp. (strain K31) GN=nuoB PE=3 SV=1 11 207 1.0E-67
sp|Q9A6X1|NUOB_CAUCR NADH-quinone oxidoreductase subunit B OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=nuoB PE=3 SV=1 27 207 8.0E-67
sp|B8GWV5|NUOB_CAUCN NADH-quinone oxidoreductase subunit B OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=nuoB PE=3 SV=1 27 207 1.0E-66
sp|Q5KUJ6|NUOB_GEOKA NADH-quinone oxidoreductase subunit B OS=Geobacillus kaustophilus (strain HTA426) GN=nuoB PE=3 SV=1 67 205 1.0E-66
sp|A4ITI6|NUOB_GEOTN NADH-quinone oxidoreductase subunit B OS=Geobacillus thermodenitrificans (strain NG80-2) GN=nuoB PE=3 SV=1 67 205 6.0E-66
sp|B4U8H3|NUOB_HYDS0 NADH-quinone oxidoreductase subunit B OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=nuoB PE=3 SV=1 65 211 1.0E-65
sp|A7GV50|NUOB_BACCN NADH-quinone oxidoreductase subunit B OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=nuoB PE=3 SV=1 67 205 2.0E-65
sp|C5D987|NUOB_GEOSW NADH-quinone oxidoreductase subunit B OS=Geobacillus sp. (strain WCH70) GN=nuoB PE=3 SV=1 50 205 5.0E-65
sp|Q26783|NDUS7_TRYBB NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Trypanosoma brucei brucei GN=NDHK PE=3 SV=1 36 211 1.0E-64
sp|Q6HAY6|NUOB_BACHK NADH-quinone oxidoreductase subunit B OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|Q630U9|NUOB_BACCZ NADH-quinone oxidoreductase subunit B OS=Bacillus cereus (strain ZK / E33L) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|A0RL90|NUOB_BACAH NADH-quinone oxidoreductase subunit B OS=Bacillus thuringiensis (strain Al Hakam) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|B7IQV2|NUOB_BACC2 NADH-quinone oxidoreductase subunit B OS=Bacillus cereus (strain G9842) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|Q814W7|NUOB_BACCR NADH-quinone oxidoreductase subunit B OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|B9IRT1|NUOB_BACCQ NADH-quinone oxidoreductase subunit B OS=Bacillus cereus (strain Q1) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|B7HY57|NUOB_BACC7 NADH-quinone oxidoreductase subunit B OS=Bacillus cereus (strain AH187) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|B7HFJ5|NUOB_BACC4 NADH-quinone oxidoreductase subunit B OS=Bacillus cereus (strain B4264) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|C1F0M2|NUOB_BACC3 NADH-quinone oxidoreductase subunit B OS=Bacillus cereus (strain 03BB102) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|Q72XF4|NUOB_BACC1 NADH-quinone oxidoreductase subunit B OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|B7JGM4|NUOB_BACC0 NADH-quinone oxidoreductase subunit B OS=Bacillus cereus (strain AH820) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|Q81K01|NUOB_BACAN NADH-quinone oxidoreductase subunit B OS=Bacillus anthracis GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|C3LFH3|NUOB_BACAC NADH-quinone oxidoreductase subunit B OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|C3P1E8|NUOB_BACAA NADH-quinone oxidoreductase subunit B OS=Bacillus anthracis (strain A0248) GN=nuoB PE=3 SV=1 67 205 1.0E-64
sp|B7GMF0|NUOB_ANOFW NADH-quinone oxidoreductase subunit B OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=nuoB PE=3 SV=1 67 205 2.0E-64
sp|A9VS97|NUOB_BACWK NADH-quinone oxidoreductase subunit B OS=Bacillus weihenstephanensis (strain KBAB4) GN=nuoB PE=3 SV=1 67 205 2.0E-64
sp|O67334|NUOB_AQUAE NADH-quinone oxidoreductase subunit B OS=Aquifex aeolicus (strain VF5) GN=nuoB PE=3 SV=1 65 211 3.0E-64
sp|Q30PH9|NUOB_SULDN NADH-quinone oxidoreductase subunit B OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=nuoB PE=3 SV=1 60 211 5.0E-64
sp|Q3JNA0|NUOB2_BURP1 Putative NADH-quinone oxidoreductase subunit B 2 OS=Burkholderia pseudomallei (strain 1710b) GN=nuoB2 PE=3 SV=2 65 204 6.0E-64
sp|B5EFG2|NUOB_GEOBB NADH-quinone oxidoreductase subunit B OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=nuoB PE=3 SV=1 68 208 2.0E-63
sp|C6E8N4|NUOB_GEOSM NADH-quinone oxidoreductase subunit B OS=Geobacter sp. (strain M21) GN=nuoB PE=3 SV=1 68 208 3.0E-63
sp|B3ET80|NUOB_AMOA5 NADH-quinone oxidoreductase subunit B OS=Amoebophilus asiaticus (strain 5a2) GN=nuoB PE=3 SV=1 53 205 3.0E-63
sp|Q24UB6|NUOB_DESHY NADH-quinone oxidoreductase subunit B OS=Desulfitobacterium hafniense (strain Y51) GN=nuoB PE=3 SV=1 45 212 7.0E-63
sp|B8FRK6|NUOB_DESHD NADH-quinone oxidoreductase subunit B OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=nuoB PE=3 SV=1 45 212 7.0E-63
sp|Q74GA7|NUOB_GEOSL NADH-quinone oxidoreductase subunit B OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoB PE=3 SV=1 64 208 2.0E-62
sp|B5Z8Q6|NUOB_HELPG NADH-quinone oxidoreductase subunit B OS=Helicobacter pylori (strain G27) GN=nuoB PE=3 SV=1 67 211 2.0E-62
sp|B6JNA1|NUOB_HELP2 NADH-quinone oxidoreductase subunit B OS=Helicobacter pylori (strain P12) GN=nuoB PE=3 SV=1 67 211 2.0E-62
sp|B5YL35|NUOB2_THEYD NADH-quinone oxidoreductase subunit B 2 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=nuoB2 PE=3 SV=1 56 204 2.0E-62
sp|Q7MA50|NUOB_WOLSU NADH-quinone oxidoreductase subunit B OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=nuoB PE=3 SV=1 61 211 3.0E-62
sp|Q17Z53|NUOB_HELAH NADH-quinone oxidoreductase subunit B OS=Helicobacter acinonychis (strain Sheeba) GN=nuoB PE=3 SV=1 67 211 3.0E-62
sp|A6Q1P4|NUOB_NITSB NADH-quinone oxidoreductase subunit B OS=Nitratiruptor sp. (strain SB155-2) GN=nuoB PE=3 SV=1 48 209 3.0E-62
sp|O25851|NUOB_HELPY NADH-quinone oxidoreductase subunit B OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nuoB PE=3 SV=1 67 211 3.0E-62
sp|B2UV25|NUOB_HELPS NADH-quinone oxidoreductase subunit B OS=Helicobacter pylori (strain Shi470) GN=nuoB PE=3 SV=1 67 211 3.0E-62
sp|Q1CS00|NUOB_HELPH NADH-quinone oxidoreductase subunit B OS=Helicobacter pylori (strain HPAG1) GN=nuoB PE=3 SV=1 67 211 3.0E-62
sp|Q9ZJW6|NUOB_HELPJ NADH-quinone oxidoreductase subunit B OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nuoB PE=3 SV=1 67 211 4.0E-62
sp|A5G9B8|NUOB_GEOUR NADH-quinone oxidoreductase subunit B OS=Geobacter uraniireducens (strain Rf4) GN=nuoB PE=3 SV=1 68 208 4.0E-62
sp|B9LZL8|NUOB_GEODF NADH-quinone oxidoreductase subunit B OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=nuoB PE=3 SV=1 68 208 8.0E-62
sp|Q11XR8|NUOB1_CYTH3 NADH-quinone oxidoreductase subunit B 1 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=nuoB1 PE=3 SV=2 53 210 3.0E-61
sp|B2V988|NUOB_SULSY NADH-quinone oxidoreductase subunit B OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=nuoB PE=3 SV=1 67 201 4.0E-61
sp|A6QCG2|NUOB_SULNB NADH-quinone oxidoreductase subunit B OS=Sulfurovum sp. (strain NBC37-1) GN=nuoB PE=3 SV=1 66 205 5.0E-61
sp|Q39QA8|NUOB_GEOMG NADH-quinone oxidoreductase subunit B OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoB PE=3 SV=1 65 208 5.0E-61
sp|B3PY57|NUOB2_RHIE6 NADH-quinone oxidoreductase subunit B 2 OS=Rhizobium etli (strain CIAT 652) GN=nuoB2 PE=3 SV=1 67 208 6.0E-61
sp|B3E9W8|NUOB_GEOLS NADH-quinone oxidoreductase subunit B OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=nuoB PE=3 SV=1 67 204 9.0E-61
sp|A7HZU9|NUOB_CAMHC NADH-quinone oxidoreductase subunit B OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=nuoB PE=3 SV=1 67 211 1.0E-60
sp|B5YKI3|NUOB1_THEYD NADH-quinone oxidoreductase subunit B 1 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=nuoB1 PE=3 SV=1 52 206 1.0E-60
sp|Q2K3U4|NUOB3_RHIEC NADH-quinone oxidoreductase subunit B 3 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoB3 PE=3 SV=1 67 208 1.0E-60
sp|P56897|NUOB2_RHIME NADH-quinone oxidoreductase subunit B 2 OS=Rhizobium meliloti (strain 1021) GN=nuoB2 PE=3 SV=2 67 208 2.0E-60
sp|A0LRI2|NUOB_ACIC1 NADH-quinone oxidoreductase subunit B OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=nuoB PE=3 SV=1 65 209 8.0E-60
sp|A7ZBE5|NUOB_CAMC1 NADH-quinone oxidoreductase subunit B OS=Campylobacter concisus (strain 13826) GN=nuoB PE=3 SV=1 60 211 1.0E-59
sp|Q7VFS3|NUOB_HELHP NADH-quinone oxidoreductase subunit B OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=nuoB PE=3 SV=1 66 208 3.0E-59
sp|Q9RU87|NUOB_DEIRA NADH-quinone oxidoreductase subunit B OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=nuoB PE=3 SV=1 56 212 7.0E-59
sp|Q8KEC2|NUOB_CHLTE NADH-quinone oxidoreductase subunit B OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=nuoB PE=3 SV=1 67 205 9.0E-59
sp|Q3Z800|NUOB_DEHM1 NADH-quinone oxidoreductase subunit B OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=nuoB PE=3 SV=1 38 211 9.0E-59
sp|Q3ZXS0|NUOB_DEHMC NADH-quinone oxidoreductase subunit B OS=Dehalococcoides mccartyi (strain CBDB1) GN=nuoB PE=3 SV=1 53 211 1.0E-58
sp|Q5HSL3|NUOB_CAMJR NADH-quinone oxidoreductase subunit B OS=Campylobacter jejuni (strain RM1221) GN=nuoB PE=3 SV=1 67 211 1.0E-58
sp|A1W1H7|NUOB_CAMJJ NADH-quinone oxidoreductase subunit B OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=nuoB PE=3 SV=1 67 211 1.0E-58
sp|Q0P850|NUOB_CAMJE NADH-quinone oxidoreductase subunit B OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=nuoB PE=3 SV=1 67 211 1.0E-58
sp|A7H5T0|NUOB_CAMJD NADH-quinone oxidoreductase subunit B OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=nuoB PE=3 SV=1 67 211 1.0E-58
sp|A8FNN6|NUOB_CAMJ8 NADH-quinone oxidoreductase subunit B OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=nuoB PE=3 SV=1 67 211 1.0E-58
sp|A7GW69|NUOB_CAMC5 NADH-quinone oxidoreductase subunit B OS=Campylobacter curvus (strain 525.92) GN=nuoB PE=3 SV=1 60 211 1.0E-58
sp|A5FQY4|NUOB_DEHMB NADH-quinone oxidoreductase subunit B OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=nuoB PE=3 SV=1 53 211 6.0E-58
sp|B8J1D6|NUOB_DESDA NADH-quinone oxidoreductase subunit B OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=nuoB PE=3 SV=1 70 209 6.0E-58
sp|Q1IL91|NUOB2_KORVE NADH-quinone oxidoreductase subunit B 2 OS=Koribacter versatilis (strain Ellin345) GN=nuoB2 PE=3 SV=1 64 211 6.0E-58
sp|C1D0H2|NUOB_DEIDV NADH-quinone oxidoreductase subunit B OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=nuoB PE=3 SV=1 56 212 7.0E-58
sp|B4S752|NUOB_PROA2 NADH-quinone oxidoreductase subunit B OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=nuoB PE=3 SV=1 67 209 7.0E-58
sp|B9L170|NUOB_THERP NADH-quinone oxidoreductase subunit B OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=nuoB PE=3 SV=1 68 204 8.0E-58
sp|B3EKA0|NUOB_CHLPB NADH-quinone oxidoreductase subunit B OS=Chlorobium phaeobacteroides (strain BS1) GN=nuoB PE=3 SV=1 67 209 1.0E-57
sp|A9B4Z5|NUOB1_HERA2 NADH-quinone oxidoreductase subunit B 1 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=nuoB1 PE=3 SV=1 53 210 1.0E-57
sp|B3QY47|NUOB2_CHLT3 NADH-quinone oxidoreductase subunit B 2 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nuoB2 PE=3 SV=1 67 210 1.0E-57
sp|A4SF47|NUOB_CHLPM NADH-quinone oxidoreductase subunit B OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=nuoB PE=3 SV=1 67 205 1.0E-57
sp|B0TH78|NUOB_HELMI NADH-quinone oxidoreductase subunit B OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=nuoB PE=3 SV=1 67 206 2.0E-57
sp|A6LXQ4|NUOB_CLOB8 NADH-quinone oxidoreductase subunit B OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=nuoB PE=3 SV=1 56 208 2.0E-57
sp|Q3ASW7|NUOB_CHLCH NADH-quinone oxidoreductase subunit B OS=Chlorobium chlorochromatii (strain CaD3) GN=nuoB PE=3 SV=1 67 209 2.0E-57
sp|B3EI94|NUOB_CHLL2 NADH-quinone oxidoreductase subunit B OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=nuoB PE=3 SV=1 67 209 3.0E-57
sp|Q1IZX2|NUOB_DEIGD NADH-quinone oxidoreductase subunit B OS=Deinococcus geothermalis (strain DSM 11300) GN=nuoB PE=3 SV=1 56 206 3.0E-57
sp|A8LCA0|NUOB_FRASN NADH-quinone oxidoreductase subunit B OS=Frankia sp. (strain EAN1pec) GN=nuoB PE=3 SV=1 67 204 3.0E-57
sp|B3QP57|NUOB_CHLP8 NADH-quinone oxidoreductase subunit B OS=Chlorobaculum parvum (strain NCIB 8327) GN=nuoB PE=3 SV=1 67 205 3.0E-57
sp|Q0RRW7|NUOB_FRAAA NADH-quinone oxidoreductase subunit B OS=Frankia alni (strain ACN14a) GN=nuoB PE=3 SV=2 67 210 5.0E-57
sp|B4SBZ2|NUOB_PELPB NADH-quinone oxidoreductase subunit B OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=nuoB PE=3 SV=1 61 209 5.0E-57
sp|Q2JFL9|NUOB_FRASC NADH-quinone oxidoreductase subunit B OS=Frankia sp. (strain CcI3) GN=nuoB PE=3 SV=1 67 210 5.0E-57
sp|A1BF33|NUOB_CHLPD NADH-quinone oxidoreductase subunit B OS=Chlorobium phaeobacteroides (strain DSM 266) GN=nuoB PE=3 SV=1 67 209 9.0E-57
sp|Q72GC9|NUOB_THET2 NADH-quinone oxidoreductase subunit B OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=nuoB PE=3 SV=1 67 206 2.0E-56
sp|Q56218|NQO6_THET8 NADH-quinone oxidoreductase subunit 6 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo6 PE=1 SV=3 67 206 2.0E-56
sp|Q9XAQ5|NUOB1_STRCO NADH-quinone oxidoreductase subunit B 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nuoB1 PE=3 SV=1 65 209 3.0E-56
sp|B1W518|NUOB1_STRGG NADH-quinone oxidoreductase subunit B 1 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=nuoB1 PE=3 SV=1 65 209 4.0E-56
sp|Q3B4W2|NUOB_CHLL7 NADH-quinone oxidoreductase subunit B OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=nuoB PE=3 SV=1 70 209 5.0E-56
sp|Q020B6|NUOB1_SOLUE NADH-quinone oxidoreductase subunit B 1 OS=Solibacter usitatus (strain Ellin6076) GN=nuoB1 PE=3 SV=1 64 204 6.0E-56
sp|B8GA16|NUOB2_CHLAD NADH-quinone oxidoreductase subunit B 2 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=nuoB2 PE=3 SV=1 67 214 9.0E-56
sp|B9LGT9|NUOB1_CHLSY NADH-quinone oxidoreductase subunit B 1 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=nuoB1 PE=3 SV=1 67 214 9.0E-56
sp|A9WED9|NUOB1_CHLAA NADH-quinone oxidoreductase subunit B 1 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=nuoB1 PE=3 SV=1 67 214 9.0E-56
sp|A7H9V0|NUOB1_ANADF NADH-quinone oxidoreductase subunit B 1 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=nuoB1 PE=3 SV=1 56 206 1.0E-55
sp|Q82DY0|NUOB1_STRAW NADH-quinone oxidoreductase subunit B 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nuoB1 PE=3 SV=1 65 209 2.0E-55
sp|Q1IPE7|NUOB1_KORVE NADH-quinone oxidoreductase subunit B 1 OS=Koribacter versatilis (strain Ellin345) GN=nuoB1 PE=3 SV=1 56 205 2.0E-55
sp|Q6A6F9|NUOB_PROAC NADH-quinone oxidoreductase subunit B OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=nuoB PE=3 SV=1 67 206 2.0E-55
sp|A7NL05|NUOB2_ROSCS NADH-quinone oxidoreductase subunit B 2 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=nuoB2 PE=3 SV=1 49 214 2.0E-55
sp|B3QUS2|NUOB1_CHLT3 NADH-quinone oxidoreductase subunit B 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nuoB1 PE=3 SV=1 65 208 2.0E-55
sp|A4FPU0|NUOB_SACEN NADH-quinone oxidoreductase subunit B OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=nuoB PE=3 SV=1 67 210 3.0E-55
sp|Q3AC78|NUOB_CARHZ NADH-quinone oxidoreductase subunit B OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=nuoB PE=3 SV=1 67 211 3.0E-55
sp|Q8A0F5|NUOB_BACTN NADH-quinone oxidoreductase subunit B OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=nuoB PE=3 SV=1 53 209 4.0E-55
sp|A5UXK1|NUOB1_ROSS1 NADH-quinone oxidoreductase subunit B 1 OS=Roseiflexus sp. (strain RS-1) GN=nuoB1 PE=3 SV=1 49 214 4.0E-55
sp|Q2RJU6|NUOB_MOOTA NADH-quinone oxidoreductase subunit B OS=Moorella thermoacetica (strain ATCC 39073) GN=nuoB PE=3 SV=1 67 210 9.0E-55
sp|Q01VP7|NUOB2_SOLUE NADH-quinone oxidoreductase subunit B 2 OS=Solibacter usitatus (strain Ellin6076) GN=nuoB2 PE=3 SV=1 67 206 1.0E-54
sp|Q47LE5|NUOB_THEFY NADH-quinone oxidoreductase subunit B OS=Thermobifida fusca (strain YX) GN=nuoB PE=3 SV=1 67 209 1.0E-54
sp|A8M621|NUOB2_SALAI NADH-quinone oxidoreductase subunit B 2 OS=Salinispora arenicola (strain CNS-205) GN=nuoB2 PE=3 SV=1 67 204 2.0E-54
sp|A4XC37|NUOB2_SALTO NADH-quinone oxidoreductase subunit B 2 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=nuoB2 PE=3 SV=1 67 204 2.0E-54
sp|C0ZYJ9|NUOB_RHOE4 NADH-quinone oxidoreductase subunit B OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=nuoB PE=3 SV=1 65 206 2.0E-54
sp|A1SE28|NUOB_NOCSJ NADH-quinone oxidoreductase subunit B OS=Nocardioides sp. (strain BAA-499 / JS614) GN=nuoB PE=3 SV=1 67 209 2.0E-54
sp|A9G9S9|NUOB2_SORC5 NADH-quinone oxidoreductase subunit B 2 OS=Sorangium cellulosum (strain So ce56) GN=nuoB2 PE=3 SV=1 39 208 2.0E-54
sp|Q64Y07|NUOB_BACFR NADH-quinone oxidoreductase subunit B OS=Bacteroides fragilis (strain YCH46) GN=nuoB PE=3 SV=1 56 209 5.0E-54
sp|Q5LH49|NUOB_BACFN NADH-quinone oxidoreductase subunit B OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=nuoB PE=3 SV=1 56 209 5.0E-54
sp|B9LAU1|NUOB2_CHLSY NADH-quinone oxidoreductase subunit B 2 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=nuoB2 PE=3 SV=1 57 210 5.0E-54
sp|A9WFB2|NUOB2_CHLAA NADH-quinone oxidoreductase subunit B 2 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=nuoB2 PE=3 SV=1 57 210 5.0E-54
sp|A6L170|NUOB_BACV8 NADH-quinone oxidoreductase subunit B OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=nuoB PE=3 SV=1 55 209 5.0E-54
sp|Q6MDR5|NUOB_PARUW NADH-quinone oxidoreductase subunit B OS=Protochlamydia amoebophila (strain UWE25) GN=nuoB PE=3 SV=1 65 205 6.0E-54
sp|Q2IL09|NUOB2_ANADE NADH-quinone oxidoreductase subunit B 2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=nuoB2 PE=3 SV=1 56 206 9.0E-54
sp|Q73V14|NUOB_MYCPA NADH-quinone oxidoreductase subunit B OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=nuoB PE=3 SV=1 67 206 9.0E-54
sp|A0QJU8|NUOB_MYCA1 NADH-quinone oxidoreductase subunit B OS=Mycobacterium avium (strain 104) GN=nuoB PE=3 SV=1 67 206 9.0E-54
sp|C5C0S6|NUOB_BEUC1 NADH-quinone oxidoreductase subunit B OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=nuoB PE=3 SV=1 65 209 1.0E-53
sp|B8G705|NUOB1_CHLAD NADH-quinone oxidoreductase subunit B 1 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=nuoB1 PE=3 SV=1 57 210 1.0E-53
sp|B4UIA4|NUOB1_ANASK NADH-quinone oxidoreductase subunit B 1 OS=Anaeromyxobacter sp. (strain K) GN=nuoB1 PE=3 SV=1 56 206 1.0E-53
sp|A9B478|NUOB2_HERA2 NADH-quinone oxidoreductase subunit B 2 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=nuoB2 PE=3 SV=1 67 214 1.0E-53
sp|B1W4V9|NUOB2_STRGG NADH-quinone oxidoreductase subunit B 2 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=nuoB2 PE=3 SV=1 34 213 2.0E-53
sp|Q9F2W1|NUOB2_STRCO NADH-quinone oxidoreductase subunit B 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nuoB2 PE=3 SV=1 51 204 3.0E-53
sp|B1MPG5|NUOB_MYCA9 NADH-quinone oxidoreductase subunit B OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=nuoB PE=3 SV=1 65 206 3.0E-53
sp|A4TDB9|NUOB_MYCGI NADH-quinone oxidoreductase subunit B OS=Mycobacterium gilvum (strain PYR-GCK) GN=nuoB PE=3 SV=1 67 206 4.0E-53
sp|Q1AVI4|NUOB_RUBXD NADH-quinone oxidoreductase subunit B OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=nuoB PE=3 SV=1 68 208 4.0E-53
sp|Q82DT6|NUOB2_STRAW NADH-quinone oxidoreductase subunit B 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nuoB2 PE=3 SV=1 45 213 4.0E-53
sp|A1T6A5|NUOB_MYCVP NADH-quinone oxidoreductase subunit B OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=nuoB PE=3 SV=1 67 206 6.0E-53
sp|A0QU35|NUOB_MYCS2 NADH-quinone oxidoreductase subunit B OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=nuoB PE=3 SV=1 67 206 8.0E-53
sp|B1ZUJ0|NUOB2_OPITP NADH-quinone oxidoreductase subunit B 2 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=nuoB2 PE=3 SV=1 67 208 9.0E-53
sp|B2UPT6|NUOB_AKKM8 NADH-quinone oxidoreductase subunit B OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=nuoB PE=3 SV=1 64 216 1.0E-52
sp|Q1BBP4|NUOB_MYCSS NADH-quinone oxidoreductase subunit B OS=Mycobacterium sp. (strain MCS) GN=nuoB PE=3 SV=1 67 206 1.0E-52
sp|A3PWS0|NUOB_MYCSJ NADH-quinone oxidoreductase subunit B OS=Mycobacterium sp. (strain JLS) GN=nuoB PE=3 SV=1 67 206 1.0E-52
sp|A0PR39|NUOB_MYCUA NADH-quinone oxidoreductase subunit B OS=Mycobacterium ulcerans (strain Agy99) GN=nuoB PE=3 SV=1 67 206 1.0E-52
sp|B2HGE7|NUOB_MYCMM NADH-quinone oxidoreductase subunit B OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=nuoB PE=3 SV=1 67 206 1.0E-52
sp|A8M069|NUOB1_SALAI NADH-quinone oxidoreductase subunit B 1 OS=Salinispora arenicola (strain CNS-205) GN=nuoB1 PE=3 SV=1 73 204 1.0E-52
sp|A4X1X5|NUOB1_SALTO NADH-quinone oxidoreductase subunit B 1 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=nuoB1 PE=3 SV=1 73 204 2.0E-52
sp|P9WJH1|NUOB_MYCTU NADH-quinone oxidoreductase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nuoB PE=1 SV=1 67 206 2.0E-52
sp|P9WJH0|NUOB_MYCTO NADH-quinone oxidoreductase subunit B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nuoB PE=3 SV=1 67 206 2.0E-52
sp|A5U7G2|NUOB_MYCTA NADH-quinone oxidoreductase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=nuoB PE=3 SV=1 67 206 2.0E-52
sp|C1AGR3|NUOB_MYCBT NADH-quinone oxidoreductase subunit B OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=nuoB PE=3 SV=1 67 206 2.0E-52
sp|A1KNE2|NUOB_MYCBP NADH-quinone oxidoreductase subunit B OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=nuoB PE=3 SV=1 67 206 2.0E-52
sp|P65576|NUOB_MYCBO NADH-quinone oxidoreductase subunit B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nuoB PE=3 SV=1 67 206 2.0E-52
sp|A7NIW1|NUOB1_ROSCS NADH-quinone oxidoreductase subunit B 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=nuoB1 PE=3 SV=1 57 209 3.0E-52
sp|Q5YWC8|NUOB_NOCFA NADH-quinone oxidoreductase subunit B OS=Nocardia farcinica (strain IFM 10152) GN=nuoB PE=3 SV=1 65 209 3.0E-52
sp|Q8DKZ4|NDHK_THEEB NAD(P)H-quinone oxidoreductase subunit K OS=Thermosynechococcus elongatus (strain BP-1) GN=ndhK PE=1 SV=1 38 211 3.0E-52
sp|A5UZH9|NUOB2_ROSS1 NADH-quinone oxidoreductase subunit B 2 OS=Roseiflexus sp. (strain RS-1) GN=nuoB2 PE=3 SV=1 57 209 3.0E-52
sp|Q0S449|NUOB_RHOJR NADH-quinone oxidoreductase subunit B OS=Rhodococcus jostii (strain RHA1) GN=nuoB PE=3 SV=1 65 206 4.0E-52
sp|C1AYM4|NUOB_RHOOB NADH-quinone oxidoreductase subunit B OS=Rhodococcus opacus (strain B4) GN=nuoB PE=3 SV=1 65 206 5.0E-52
sp|A0RMD0|NUOB_CAMFF NADH-quinone oxidoreductase subunit B OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=nuoB PE=3 SV=1 58 209 7.0E-52
sp|B3DXN5|NUOB_METI4 NADH-quinone oxidoreductase subunit B OS=Methylacidiphilum infernorum (isolate V4) GN=nuoB PE=3 SV=1 67 204 1.0E-51
sp|A8G2V4|NDHK_PROM2 NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus (strain MIT 9215) GN=ndhK PE=3 SV=1 67 209 1.0E-51
sp|A2BP93|NDHK_PROMS NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus (strain AS9601) GN=ndhK PE=3 SV=1 67 209 2.0E-51
sp|Q31CN9|NDHK_PROM9 NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus (strain MIT 9312) GN=ndhK PE=3 SV=1 67 209 2.0E-51
sp|A3PB15|NDHK_PROM0 NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus (strain MIT 9301) GN=ndhK PE=3 SV=1 67 209 2.0E-51
sp|A5GIB4|NDHK_SYNPW NAD(P)H-quinone oxidoreductase subunit K OS=Synechococcus sp. (strain WH7803) GN=ndhK PE=3 SV=1 52 209 2.0E-51
sp|Q5N560|NDHK_SYNP6 NAD(P)H-quinone oxidoreductase subunit K OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ndhK PE=3 SV=1 52 209 2.0E-51
sp|Q31P08|NDHK_SYNE7 NAD(P)H-quinone oxidoreductase subunit K OS=Synechococcus elongatus (strain PCC 7942) GN=ndhK PE=3 SV=1 52 209 2.0E-51
sp|B8DS03|NUOB_DESVM NADH-quinone oxidoreductase subunit B OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=nuoB PE=3 SV=1 73 214 2.0E-51
sp|Q7V303|NDHK_PROMP NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ndhK PE=3 SV=1 67 209 2.0E-51
sp|A2BUS4|NDHK_PROM5 NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus (strain MIT 9515) GN=ndhK PE=3 SV=1 67 209 3.0E-51
sp|Q67P21|NUOB1_SYMTH NADH-quinone oxidoreductase subunit B 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nuoB1 PE=3 SV=2 65 206 3.0E-51
sp|Q6MIR4|NUOB_BDEBA NADH-quinone oxidoreductase subunit B OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=nuoB PE=3 SV=1 65 213 4.0E-51
sp|A5GQF8|NDHK_SYNR3 NAD(P)H-quinone oxidoreductase subunit K OS=Synechococcus sp. (strain RCC307) GN=ndhK PE=3 SV=1 52 211 5.0E-51
sp|Q7NML6|NDHK1_GLOVI NAD(P)H-quinone oxidoreductase subunit K 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=ndhK1 PE=3 SV=1 50 209 5.0E-51
sp|A2CCP6|NDHK_PROM3 NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus (strain MIT 9303) GN=ndhK PE=3 SV=1 52 211 5.0E-51
sp|B0JSV5|NDHK_MICAN NAD(P)H-quinone oxidoreductase subunit K OS=Microcystis aeruginosa (strain NIES-843) GN=ndhK PE=3 SV=1 67 209 6.0E-51
sp|B1X4R2|NDHK_PAUCH NAD(P)H-quinone oxidoreductase subunit K, organellar chromatophore OS=Paulinella chromatophora GN=ndhK PE=3 SV=1 52 209 7.0E-51
sp|Q9XBL7|NDHK_ANAVT NAD(P)H-quinone oxidoreductase subunit K OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ndhK PE=3 SV=1 50 206 7.0E-51
sp|Q6YXQ9|NDHK_PHYPA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Physcomitrella patens subsp. patens GN=ndhK PE=3 SV=1 53 204 7.0E-51
sp|A2C0C7|NDHK_PROM1 NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus (strain NATL1A) GN=ndhK PE=3 SV=1 52 211 7.0E-51
sp|Q46M05|NDHK_PROMT NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus (strain NATL2A) GN=ndhK PE=3 SV=1 52 211 8.0E-51
sp|Q3B0C2|NDHK_SYNS9 NAD(P)H-quinone oxidoreductase subunit K OS=Synechococcus sp. (strain CC9902) GN=ndhK PE=3 SV=1 37 211 1.0E-50
sp|Q44240|NDHK_NOSS1 NAD(P)H-quinone oxidoreductase subunit K OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ndhK PE=3 SV=2 50 206 1.0E-50
sp|P06410|NDHK_MARPO NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Marchantia polymorpha GN=ndhK PE=3 SV=1 38 204 1.0E-50
sp|Q3AN52|NDHK_SYNSC NAD(P)H-quinone oxidoreductase subunit K OS=Synechococcus sp. (strain CC9605) GN=ndhK PE=3 SV=1 52 209 1.0E-50
sp|Q7VDP4|NDHK_PROMA NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ndhK PE=3 SV=1 52 206 1.0E-50
sp|Q0IDJ3|NDHK_SYNS3 NAD(P)H-quinone oxidoreductase subunit K OS=Synechococcus sp. (strain CC9311) GN=ndhK PE=3 SV=2 52 210 1.0E-50
sp|Q7U9P5|NDHK_SYNPX NAD(P)H-quinone oxidoreductase subunit K OS=Synechococcus sp. (strain WH8102) GN=ndhK PE=3 SV=1 52 209 1.0E-50
sp|Q7V4Q5|NDHK_PROMM NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus (strain MIT 9313) GN=ndhK PE=3 SV=1 67 211 2.0E-50
sp|A9BDU0|NDHK_PROM4 NAD(P)H-quinone oxidoreductase subunit K OS=Prochlorococcus marinus (strain MIT 9211) GN=ndhK PE=3 SV=1 52 206 2.0E-50
sp|Q8M9X9|NDHK_CHAGL NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Chaetosphaeridium globosum GN=ndhK PE=3 SV=1 56 204 3.0E-50
sp|A2CI36|NDHK_CHLAT NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Chlorokybus atmophyticus GN=ndhK PE=3 SV=2 46 204 3.0E-50
sp|F1SVH7|FPOB_METMA F(420)H(2) dehydrogenase subunit B OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fpoB PE=1 SV=1 40 208 4.0E-50
sp|B7K0X4|NDHK_CYAP8 NAD(P)H-quinone oxidoreductase subunit K OS=Cyanothece sp. (strain PCC 8801) GN=ndhK PE=3 SV=1 67 209 5.0E-50
sp|B1XMK4|NDHK_SYNP2 NAD(P)H-quinone oxidoreductase subunit K OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ndhK PE=3 SV=1 67 209 5.0E-50
sp|B5E972|NUBCD_GEOBB NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=nuoBCD PE=3 SV=1 67 208 7.0E-50
sp|P17062|NDHK2_SYNY3 NAD(P)H-quinone oxidoreductase subunit K 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ndhK2 PE=3 SV=1 39 204 7.0E-50
sp|B2J6S6|NDHK_NOSP7 NAD(P)H-quinone oxidoreductase subunit K OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ndhK PE=3 SV=1 67 209 8.0E-50
sp|B7KJ51|NDHK_CYAP7 NAD(P)H-quinone oxidoreductase subunit K OS=Cyanothece sp. (strain PCC 7424) GN=ndhK PE=3 SV=1 39 209 8.0E-50
sp|B1WZG1|NDHK_CYAA5 NAD(P)H-quinone oxidoreductase subunit K OS=Cyanothece sp. (strain ATCC 51142) GN=ndhK PE=3 SV=1 67 209 8.0E-50
sp|Q8WI14|NDHK_PSINU NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Psilotum nudum GN=ndhK PE=3 SV=1 53 204 8.0E-50
sp|Q31791|NDHK_ANTFO NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Anthoceros formosae GN=ndhK PE=2 SV=3 31 202 1.0E-49
sp|Q85XC3|NDHK_HORVU NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Hordeum vulgare GN=ndhK PE=1 SV=2 50 204 1.0E-49
sp|Q608X8|NUOB_METCA NADH-quinone oxidoreductase subunit B OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=nuoB PE=3 SV=1 56 204 1.0E-49
sp|Q10YT4|NDHK_TRIEI NAD(P)H-quinone oxidoreductase subunit K OS=Trichodesmium erythraeum (strain IMS101) GN=ndhK PE=3 SV=1 44 209 1.0E-49
sp|Q2YAA4|NUOB1_NITMU NADH-quinone oxidoreductase subunit B 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoB1 PE=3 SV=1 35 213 1.0E-49
sp|O98679|NDHK_PEA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Pisum sativum GN=ndhK PE=1 SV=1 50 204 1.0E-49
sp|P19050|NDHK1_SYNY3 NAD(P)H-quinone oxidoreductase subunit K 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ndhK1 PE=1 SV=1 67 209 1.0E-49
sp|B1VKF5|NDHK_CRYJA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Cryptomeria japonica GN=ndhK PE=3 SV=2 68 204 2.0E-49
sp|P0C343|NDHK_ORYSJ NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oryza sativa subsp. japonica GN=ndhK PE=3 SV=2 50 204 2.0E-49
sp|P0C342|NDHK_ORYSI NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oryza sativa subsp. indica GN=ndhK PE=3 SV=2 50 204 2.0E-49
sp|P0C341|NDHK_ORYSA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oryza sativa GN=ndhK PE=3 SV=2 50 204 2.0E-49
sp|Q6ENH0|NDHK_ORYNI NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oryza nivara GN=ndhK PE=3 SV=2 50 204 2.0E-49
sp|P06670|NDHK_MAIZE NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Zea mays GN=ndhK PE=2 SV=3 50 204 2.0E-49
sp|Q9MUR0|NDHK_MESVI NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Mesostigma viride GN=ndhK PE=3 SV=1 64 204 2.0E-49
sp|Q746S4|NUBCD_GEOSL NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoBCD PE=3 SV=1 67 205 2.0E-49
sp|B1ZRT2|NUOB1_OPITP NADH-quinone oxidoreductase subunit B 1 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=nuoB1 PE=3 SV=1 67 215 2.0E-49
sp|P31175|NDHK_SOYBN NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Glycine max GN=ndhK PE=2 SV=2 50 204 3.0E-49
sp|B1KJU9|NUOB_SHEWM NADH-quinone oxidoreductase subunit B OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nuoB PE=3 SV=1 67 206 4.0E-49
sp|A5GCZ4|NUBCD_GEOUR NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter uraniireducens (strain Rf4) GN=nuoBCD PE=3 SV=1 67 208 4.0E-49
sp|A0A339|NDHK_COFAR NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Coffea arabica GN=ndhK PE=3 SV=1 50 204 5.0E-49
sp|Q13BH4|NUOB1_RHOPS NADH-quinone oxidoreductase subunit B 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoB1 PE=3 SV=1 67 208 5.0E-49
sp|Q39ZC4|NUBCD_GEOMG NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoBCD PE=3 SV=1 66 208 5.0E-49
sp|A2T337|NDHK_ANGEV NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Angiopteris evecta GN=ndhK PE=3 SV=1 68 204 7.0E-49
sp|B6YR59|NUOB_AZOPC NADH-quinone oxidoreductase subunit B OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=nuoB PE=3 SV=1 66 212 8.0E-49
sp|B1A939|NDHK_CARPA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Carica papaya GN=ndhK PE=3 SV=1 50 204 8.0E-49
sp|A4GG93|NDHK_PHAVU NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Phaseolus vulgaris GN=ndhK PE=3 SV=1 50 204 8.0E-49
sp|A8ERL5|NUOB_ARCB4 NADH-quinone oxidoreductase subunit B OS=Arcobacter butzleri (strain RM4018) GN=nuoB PE=3 SV=1 68 211 8.0E-49
sp|Q2VEH3|NDHK_SOLTU NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Solanum tuberosum GN=ndhK PE=3 SV=3 50 204 8.0E-49
sp|Q2MI96|NDHK_SOLLC NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Solanum lycopersicum GN=ndhK PE=3 SV=3 50 204 8.0E-49
sp|Q2MII3|NDHK_SOLBU NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Solanum bulbocastanum GN=ndhK PE=3 SV=2 50 204 8.0E-49
sp|Q3V530|NDHK_ACOCL NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Acorus calamus GN=ndhK PE=3 SV=2 50 216 9.0E-49
sp|A9LYA5|NDHK_ACOAM NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Acorus americanus GN=ndhK PE=3 SV=1 50 216 9.0E-49
sp|Q49KZ4|NDHK_EUCGG NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=ndhK PE=3 SV=2 50 204 9.0E-49
sp|B8HQR6|NDHK1_CYAP4 NAD(P)H-quinone oxidoreductase subunit K 1 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ndhK1 PE=3 SV=1 52 209 1.0E-48
sp|A7Y3E1|NDHK_IPOPU NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Ipomoea purpurea GN=ndhK PE=3 SV=1 50 204 1.0E-48
sp|Q332X4|NDHK_LACSA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Lactuca sativa GN=ndhK PE=3 SV=1 50 204 1.0E-48
sp|Q7YJW8|NDHK_CALFG NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Calycanthus floridus var. glaucus GN=ndhK PE=3 SV=2 50 204 1.0E-48
sp|Q6EW44|NDHK_NYMAL NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Nymphaea alba GN=ndhK PE=3 SV=2 50 204 1.0E-48
sp|Q9TKY0|NDHK_NEPOL NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Nephroselmis olivacea GN=ndhK PE=3 SV=1 39 204 1.0E-48
sp|B9KJI0|NUOB2_RHOSK NADH-quinone oxidoreductase subunit B 2 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=nuoB2 PE=3 SV=1 52 204 1.0E-48
sp|Q3J1Q8|NUOB2_RHOS4 NADH-quinone oxidoreductase subunit B 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoB2 PE=3 SV=1 52 204 1.0E-48
sp|A3PKI1|NUOB2_RHOS1 NADH-quinone oxidoreductase subunit B 2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoB2 PE=3 SV=1 52 204 2.0E-48
sp|Q9M3M0|NDHK_SPIOL NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Spinacia oleracea GN=ndhK PE=3 SV=3 50 204 2.0E-48
sp|Q9BBT7|NDHK_LOTJA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Lotus japonicus GN=ndhK PE=3 SV=1 50 204 2.0E-48
sp|Q33C30|NDHK_NICTO NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Nicotiana tomentosiformis GN=ndhK PE=3 SV=2 50 204 2.0E-48
sp|A8Y9H4|NDHK_LOLPR NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Lolium perenne GN=ndhK PE=3 SV=2 50 204 2.0E-48
sp|Q1KXV5|NDHK_HELAN NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Helianthus annuus GN=ndhK PE=3 SV=1 50 204 2.0E-48
sp|B2LMJ7|NDHK_GUIAB NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Guizotia abyssinica GN=ndhK PE=3 SV=1 50 204 2.0E-48
sp|Q2L909|NDHK_GOSHI NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Gossypium hirsutum GN=ndhK PE=3 SV=1 50 204 2.0E-48
sp|A0ZZ39|NDHK_GOSBA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Gossypium barbadense GN=ndhK PE=3 SV=1 50 204 2.0E-48
sp|Q8S8X1|NDHK_ATRBE NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Atropa belladonna GN=ndhK PE=3 SV=2 50 204 2.0E-48
sp|Q32RI3|NDHK_ZYGCR NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Zygnema circumcarinatum GN=ndhK PE=3 SV=1 66 204 2.0E-48
sp|A4QLB0|NDHK_LEPVR NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Lepidium virginicum GN=ndhK PE=3 SV=1 50 204 2.0E-48
sp|A4WT69|NUOB1_RHOS5 NADH-quinone oxidoreductase subunit B 1 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=nuoB1 PE=3 SV=1 65 204 2.0E-48
sp|P26304|NDHK_WHEAT NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Triticum aestivum GN=ndhK PE=3 SV=2 50 204 2.0E-48
sp|A1EA12|NDHK_AGRST NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Agrostis stolonifera GN=ndhK PE=3 SV=2 50 204 3.0E-48
sp|Q1ACK5|NDHK_CHAVU NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Chara vulgaris GN=ndhK PE=3 SV=1 67 204 3.0E-48
sp|B3TN55|NDHK_BRADI NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Brachypodium distachyon GN=ndhK PE=3 SV=2 50 204 3.0E-48
sp|A1E9S8|NDHK_SORBI NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Sorghum bicolor GN=ndhK PE=3 SV=2 50 204 3.0E-48
sp|Q6ENV9|NDHK_SACOF NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Saccharum officinarum GN=ndhK PE=3 SV=2 50 204 3.0E-48
sp|Q6L395|NDHK_SACHY NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Saccharum hybrid GN=ndhK PE=3 SV=2 50 204 3.0E-48
sp|B8D760|NUOB_BUCAT NADH-quinone oxidoreductase subunit B OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=nuoB PE=3 SV=1 70 213 3.0E-48
sp|P57253|NUOB_BUCAI NADH-quinone oxidoreductase subunit B OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nuoB PE=3 SV=1 70 213 3.0E-48
sp|B8D8V6|NUOB_BUCA5 NADH-quinone oxidoreductase subunit B OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=nuoB PE=3 SV=1 70 213 3.0E-48
sp|A1XFV9|NDHK_NUPAD NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Nuphar advena GN=ndhK PE=3 SV=2 50 204 3.0E-48
sp|P52766|NDHK_LUPLU NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Lupinus luteus GN=ndhK PE=3 SV=1 50 204 4.0E-48
sp|Q8K9Y6|NUOB_BUCAP NADH-quinone oxidoreductase subunit B OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nuoB PE=3 SV=1 70 213 4.0E-48
sp|A6H5H8|NDHK_CYCTA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Cycas taitungensis GN=ndhK PE=3 SV=2 50 204 4.0E-48
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0051540 metal cluster binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2407
MALRAKPMTALVPLRSAASFTSASRRHSSSLPQTTNPETTSTGLVTPRKEVPLASEEGTKGVIQYALTSLDVITN
WARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPEPRWV
ISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTSEALMYGIFQLQRKMRNTKITRMWYRR*
Coding >OphauG2|2407
ATGGCCCTTCGAGCCAAACCCATGACTGCCCTCGTGCCCCTTCGATCCGCCGCGTCCTTCACATCTGCCTCGCGC
CGCCATTCCAGCTCCCTTCCTCAAACGACCAACCCTGAAACCACCTCGACCGGCCTCGTCACTCCGCGCAAGGAA
GTTCCCCTAGCAAGCGAAGAAGGCACCAAGGGTGTAATCCAATATGCTCTCACATCACTCGATGTCATCACAAAC
TGGGCTCGTCAGTCCTCCCTCTGGCCCATGACCTTCGGCCTCGCCTGTTGCGCCGTCGAAATGATGCACCTCTCC
ACACCGCGCTACGATCAGGACCGTCTCGGAATCATCTTTCGTGCTTCCCCGCGCCAGTCCGATGTCATGATTGTC
GCTGGCACCCTTACCAATAAAATGGCCCCCGCCCTTCGCCAGGTTTATGATCAAATGCCCGAGCCTCGCTGGGTC
ATCTCCATGGGCTCCTGTGCAAATGGCGGTGGCTACTACCACTATTCTTATAGCGTTGTCCGCGGCTGCGATCGA
ATTGTCCCCGTCGACATTTATGTTCCCGGCTGCCCTCCAACCAGCGAGGCTCTCATGTATGGCATATTTCAGCTG
CAGCGCAAGATGCGCAACACAAAGATTACCCGCATGTGGTACAGGAGATAG
Transcript >OphauG2|2407
ATGGCCCTTCGAGCCAAACCCATGACTGCCCTCGTGCCCCTTCGATCCGCCGCGTCCTTCACATCTGCCTCGCGC
CGCCATTCCAGCTCCCTTCCTCAAACGACCAACCCTGAAACCACCTCGACCGGCCTCGTCACTCCGCGCAAGGAA
GTTCCCCTAGCAAGCGAAGAAGGCACCAAGGGTGTAATCCAATATGCTCTCACATCACTCGATGTCATCACAAAC
TGGGCTCGTCAGTCCTCCCTCTGGCCCATGACCTTCGGCCTCGCCTGTTGCGCCGTCGAAATGATGCACCTCTCC
ACACCGCGCTACGATCAGGACCGTCTCGGAATCATCTTTCGTGCTTCCCCGCGCCAGTCCGATGTCATGATTGTC
GCTGGCACCCTTACCAATAAAATGGCCCCCGCCCTTCGCCAGGTTTATGATCAAATGCCCGAGCCTCGCTGGGTC
ATCTCCATGGGCTCCTGTGCAAATGGCGGTGGCTACTACCACTATTCTTATAGCGTTGTCCGCGGCTGCGATCGA
ATTGTCCCCGTCGACATTTATGTTCCCGGCTGCCCTCCAACCAGCGAGGCTCTCATGTATGGCATATTTCAGCTG
CAGCGCAAGATGCGCAACACAAAGATTACCCGCATGTGGTACAGGAGATAG
Gene >OphauG2|2407
ATGGCCCTTCGAGGTATAGTTTCATTTCTCAGCGCCGCCTTGGTCGTCGTCCCGCCTCTTGCTTTAACCACCCCA
TGGCCTCACGACGCACCATGTCATTGCTTTCCACCCCCCCCTGGCTAACGCCTTTTTTTCTCCGAATAGCCAAAC
CCATGACTGCCCTCGTGCCCCTTCGATCCGCCGCGTCCTTCACATCTGCCTCGCGCCGCCATTCCAGCTCCCTTC
CTCAAACGACCAACCCTGAAACCACCTCGACCGGCCTCGTCACTCCGCGCAAGGAAGTTCCCCTAGCAAGCGAAG
AAGGCACCAAGGGTGTAATCCAATATGCTCTGTACGCCTGCACAAAAACCCTCCTTCTCAAGCCTTGACGCCATC
TCTAGTCTCTTGCTAAGTCTTGTTCGCCGCGCCAGCACATCACTCGATGTCATCACAAACTGGGCTCGTCAGTCC
TCCCTCTGGCCCATGACCTTCGGCCTCGCCTGTTGCGCCGTCGAAATGATGCACCTCTCCACACCGCGCTACGAT
CAGGACCGTCTCGGAATCATCTTTCGTGCTTCCCCGCGCCAGTCCGATGTCATGATTGTCGCTGGCACCCTTACC
AATAAAATGGCCCCCGCCCTTCGCCAGGTTTATGATCAAATGCCCGAGCCTCGCTGGGTCATCTCCATGGGCTCC
TGTGCAAATGGCGGTGGCTACTACCACTATTCTTATAGCGTTGTCCGCGGCTGCGATCGAATTGTCCCCGTCGAC
ATTTATGTTCCCGGCTGCCCTCCAACCAGCGAGGCTCTCATGTATGGCATATTTCAGCTGCAGCGCAAGATGCGC
AACACAAAGATTACCCGCATGTGGTACAGGAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail