Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2397
Gene name
LocationContig_186:16252..16730
Strand+
Gene length (bp)478
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00887 ACBP Acyl CoA binding protein 1.4E-17 7 85

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WN94|ACBP_RABIT Acyl-CoA-binding protein OS=Oryctolagus cuniculus GN=DBI PE=3 SV=3 9 93 4.0E-15
sp|P45883|ACBP_PELRI Acyl-CoA-binding protein homolog OS=Pelophylax ridibundus PE=1 SV=2 3 93 1.0E-14
sp|P31824|ACBP_MANSE Acyl-CoA-binding protein homolog OS=Manduca sexta PE=3 SV=1 7 93 2.0E-14
sp|P12026|ACBP_PIG Acyl-CoA-binding protein OS=Sus scrofa GN=DBI PE=1 SV=2 9 93 4.0E-14
sp|Q9PRL8|ACBP_CHICK Acyl-CoA-binding protein OS=Gallus gallus GN=DBI PE=1 SV=1 8 93 6.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WN94|ACBP_RABIT Acyl-CoA-binding protein OS=Oryctolagus cuniculus GN=DBI PE=3 SV=3 9 93 4.0E-15
sp|P45883|ACBP_PELRI Acyl-CoA-binding protein homolog OS=Pelophylax ridibundus PE=1 SV=2 3 93 1.0E-14
sp|P31824|ACBP_MANSE Acyl-CoA-binding protein homolog OS=Manduca sexta PE=3 SV=1 7 93 2.0E-14
sp|P12026|ACBP_PIG Acyl-CoA-binding protein OS=Sus scrofa GN=DBI PE=1 SV=2 9 93 4.0E-14
sp|Q9PRL8|ACBP_CHICK Acyl-CoA-binding protein OS=Gallus gallus GN=DBI PE=1 SV=1 8 93 6.0E-14
sp|P82934|ACBP_CHAVI Acyl-CoA-binding protein OS=Chaetophractus villosus GN=DBI PE=1 SV=2 9 93 1.0E-13
sp|Q9TQX6|ACBP_CANLF Acyl-CoA-binding protein OS=Canis lupus familiaris GN=DBI PE=1 SV=2 9 93 1.0E-13
sp|Q8N6N7|ACBD7_HUMAN Acyl-CoA-binding domain-containing protein 7 OS=Homo sapiens GN=ACBD7 PE=1 SV=1 9 93 2.0E-13
sp|P07107|ACBP_BOVIN Acyl-CoA-binding protein OS=Bos taurus GN=DBI PE=1 SV=2 9 93 3.0E-13
sp|P11030|ACBP_RAT Acyl-CoA-binding protein OS=Rattus norvegicus GN=Dbi PE=1 SV=3 9 93 8.0E-13
sp|Q9Y7Z3|ACBP_SCHPO Putative acyl-CoA-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1539.06 PE=3 SV=1 6 93 1.0E-12
sp|P07108|ACBP_HUMAN Acyl-CoA-binding protein OS=Homo sapiens GN=DBI PE=1 SV=2 9 93 2.0E-12
sp|P31786|ACBP_MOUSE Acyl-CoA-binding protein OS=Mus musculus GN=Dbi PE=1 SV=2 9 93 3.0E-12
sp|Q9D258|ACBD7_MOUSE Acyl-CoA-binding domain-containing protein 7 OS=Mus musculus GN=Acbd7 PE=3 SV=2 9 93 3.0E-12
sp|P0C8L7|ACBP_HYPDU Putative acyl-CoA-binding protein OS=Hypsibius dujardini PE=3 SV=1 7 93 1.0E-11
sp|Q3SZF0|ACBD7_BOVIN Acyl-CoA-binding domain-containing protein 7 OS=Bos taurus GN=ACBD7 PE=3 SV=1 9 93 6.0E-11
sp|P45882|ACBP_ANAPL Acyl-CoA-binding protein OS=Anas platyrhynchos GN=DBI PE=3 SV=1 9 93 7.0E-11
sp|Q39315|ACBP_BRANA Acyl-CoA-binding protein OS=Brassica napus PE=3 SV=1 7 88 3.0E-10
sp|P42281|ACBP_DROME Acyl-CoA-binding protein homolog OS=Drosophila melanogaster GN=Dbi PE=2 SV=1 6 92 5.0E-10
sp|O01805|ACBP1_CAEEL Acyl-CoA-binding protein homolog 1 OS=Caenorhabditis elegans GN=acbp-1 PE=3 SV=1 8 93 1.0E-09
sp|Q5FXM5|ACBP_DICDI Acyl-CoA-binding protein OS=Dictyostelium discoideum GN=acbA PE=1 SV=1 9 92 2.0E-09
sp|P31787|ACBP_YEAST Acyl-CoA-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACB1 PE=1 SV=3 6 93 1.0E-07
sp|Q39779|ACBP_GOSHI Acyl-CoA-binding protein OS=Gossypium hirsutum PE=3 SV=1 7 93 3.0E-07
sp|P57752|ACBP6_ARATH Acyl-CoA-binding domain-containing protein 6 OS=Arabidopsis thaliana GN=ACBP6 PE=1 SV=1 7 88 8.0E-07
sp|P61867|ACBP2_SACPS Acyl-CoA-binding protein 2 OS=Saccharomyces pastorianus GN=ACB2 PE=1 SV=2 6 92 1.0E-06
sp|P61868|ACBP2_SACMO Acyl-CoA-binding protein 2 OS=Saccharomyces pastorianus (strain ATCC 76670 / Carlsberg bottom yeast no.2 / CBS 1503 / CLIB 180 / NBRC 10610 / NRRL Y-1525) GN=ACB2 PE=3 SV=2 6 92 1.0E-06
sp|O09035|DBIL5_MOUSE Diazepam-binding inhibitor-like 5 OS=Mus musculus GN=Dbil5 PE=1 SV=1 9 91 3.0E-06
sp|O04066|ACBP_RICCO Acyl-CoA-binding protein OS=Ricinus communis PE=3 SV=1 7 88 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000062 fatty-acyl-CoA binding Yes
GO:0030554 adenyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901681 sulfur compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0017076 purine nucleotide binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0033218 amide binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0120227 acyl-CoA binding No
GO:1901567 fatty acid derivative binding No
GO:0032553 ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2397
MSAPQSEAFEKAVVDSKKLTSKPAHGDLLDLYALYKVSTGEDIANAATPGILDMKAKAKYNAWKKVLEAGVTDPK
QAQENYVAKVEEMKQKYGYDENKVPEAVGSA*
Coding >OphauG2|2397
ATGTCCGCCCCGCAGAGCGAAGCCTTTGAAAAGGCCGTCGTTGACTCCAAGAAGCTCACGAGCAAGCCCGCCCAT
GGCGACCTACTCGATCTCTATGCTCTCTACAAAGTGTCAACTGGCGAGGACATTGCCAATGCAGCCACTCCGGGC
ATACTTGACATGAAGGCCAAGGCCAAGTATAATGCCTGGAAAAAGGTGCTCGAAGCTGGCGTCACCGACCCAAAG
CAAGCTCAGGAAAACTATGTTGCAAAGGTCGAAGAAATGAAGCAGAAATACGGCTACGACGAAAACAAGGTTCCC
GAGGCTGTCGGCTCCGCCTAG
Transcript >OphauG2|2397
ATGTCCGCCCCGCAGAGCGAAGCCTTTGAAAAGGCCGTCGTTGACTCCAAGAAGCTCACGAGCAAGCCCGCCCAT
GGCGACCTACTCGATCTCTATGCTCTCTACAAAGTGTCAACTGGCGAGGACATTGCCAATGCAGCCACTCCGGGC
ATACTTGACATGAAGGCCAAGGCCAAGTATAATGCCTGGAAAAAGGTGCTCGAAGCTGGCGTCACCGACCCAAAG
CAAGCTCAGGAAAACTATGTTGCAAAGGTCGAAGAAATGAAGCAGAAATACGGCTACGACGAAAACAAGGTTCCC
GAGGCTGTCGGCTCCGCCTAG
Gene >OphauG2|2397
ATGTCCGCCCCGCAGAGCGAAGCCTTTGAAAAGGCCGTCGTTGACTCCAAGAAGCTCACGAGCAAGCCCGCCCAT
GGCGACCTACTCGATCTCTATGGTAGGCAGCCGTCATGAATCACGCCTCGTGTTTGACACCTTTGTACCCACTCG
GTATTAAAAATATGGCTATTCTAACAAAACTTGTTGGTTGGCACAGCTCTCTACAAAGTGTCAACTGGCGAGGAC
ATTGCCAATGCAGCCACTCCGGGCATACTTGACATGAAGGCAAGATCAACCTACCTCTTTTTGTCCACGACAAAG
TTTCTGACAGCCTCGACTGCAGGCCAAGGCCAAGTATAATGCCTGGAAAAAGGTGCTCGAAGCTGGCGTCACCGA
CCCAAAGCAAGCTCAGGAAAACTATGTTGCAAAGGTCGAAGAAATGAAGCAGAAATACGGCTACGACGAAAACAA
GGTTCCCGAGGCTGTCGGCTCCGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail