Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2395
Gene name
LocationContig_186:12770..14107
Strand+
Gene length (bp)1337
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12761 End3 Actin cytoskeleton-regulatory complex protein END3 1.5E-76 191 388
PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand 9.1E-47 3 104
PF00036 EF-hand_1 EF hand 7.5E-07 46 71

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT09|END3_MAGO7 Actin cytoskeleton-regulatory complex protein END3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=END3 PE=3 SV=1 1 396 0.0E+00
sp|L7IIY8|END3_MAGOY Actin cytoskeleton-regulatory complex protein END3 OS=Magnaporthe oryzae (strain Y34) GN=END3 PE=2 SV=1 1 396 0.0E+00
sp|A7E7N7|END3_SCLS1 Actin cytoskeleton-regulatory complex protein end3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=end3 PE=3 SV=1 4 395 0.0E+00
sp|A6SIJ6|END3_BOTFB Actin cytoskeleton-regulatory complex protein end3 OS=Botryotinia fuckeliana (strain B05.10) GN=end3 PE=3 SV=1 4 396 0.0E+00
sp|Q2H2V8|END3_CHAGB Actin cytoskeleton-regulatory complex protein END3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=END3 PE=3 SV=1 1 396 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT09|END3_MAGO7 Actin cytoskeleton-regulatory complex protein END3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=END3 PE=3 SV=1 1 396 0.0E+00
sp|L7IIY8|END3_MAGOY Actin cytoskeleton-regulatory complex protein END3 OS=Magnaporthe oryzae (strain Y34) GN=END3 PE=2 SV=1 1 396 0.0E+00
sp|A7E7N7|END3_SCLS1 Actin cytoskeleton-regulatory complex protein end3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=end3 PE=3 SV=1 4 395 0.0E+00
sp|A6SIJ6|END3_BOTFB Actin cytoskeleton-regulatory complex protein end3 OS=Botryotinia fuckeliana (strain B05.10) GN=end3 PE=3 SV=1 4 396 0.0E+00
sp|Q2H2V8|END3_CHAGB Actin cytoskeleton-regulatory complex protein END3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=END3 PE=3 SV=1 1 396 0.0E+00
sp|Q7S9V9|END3_NEUCR Actin cytoskeleton-regulatory complex protein end-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=end-3 PE=3 SV=2 1 396 0.0E+00
sp|B2AS96|END3_PODAN Actin cytoskeleton-regulatory complex protein END3 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=END3 PE=3 SV=1 1 395 0.0E+00
sp|Q5BEK7|END3_EMENI Actin cytoskeleton-regulatory complex protein end3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=end3 PE=2 SV=3 4 396 4.0E-175
sp|Q1DUU2|END3_COCIM Actin cytoskeleton-regulatory complex protein END3 OS=Coccidioides immitis (strain RS) GN=END3 PE=3 SV=1 4 395 4.0E-171
sp|A6RFP4|END3_AJECN Actin cytoskeleton-regulatory complex protein END3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=END3 PE=3 SV=2 4 395 1.0E-170
sp|Q4WSE8|END3_ASPFU Actin cytoskeleton-regulatory complex protein end3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=end3 PE=3 SV=1 4 396 7.0E-170
sp|B0XR88|END3_ASPFC Actin cytoskeleton-regulatory complex protein end3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=end3 PE=3 SV=1 4 396 7.0E-170
sp|A1D2B8|END3_NEOFI Actin cytoskeleton-regulatory complex protein end3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=end3 PE=3 SV=1 4 396 6.0E-169
sp|A2QRG2|END3_ASPNC Actin cytoskeleton-regulatory complex protein end3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=end3 PE=3 SV=1 4 395 3.0E-168
sp|Q0D0N9|END3_ASPTN Actin cytoskeleton-regulatory complex protein end3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=end3 PE=3 SV=1 4 395 1.0E-167
sp|A1CPG1|END3_ASPCL Actin cytoskeleton-regulatory complex protein end3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=end3 PE=3 SV=1 4 395 4.0E-167
sp|Q2UCH0|END3_ASPOR Actin cytoskeleton-regulatory complex protein end3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=end3 PE=3 SV=1 4 396 1.0E-165
sp|Q6C370|END3_YARLI Actin cytoskeleton-regulatory complex protein END3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=END3 PE=3 SV=1 4 396 3.0E-112
sp|A3M008|END3_PICST Actin cytoskeleton-regulatory complex protein END3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=END3 PE=3 SV=2 3 396 9.0E-106
sp|A5DF78|END3_PICGU Actin cytoskeleton-regulatory complex protein END3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=END3 PE=3 SV=2 3 391 2.0E-105
sp|Q5AJ82|END3_CANAL Actin cytoskeleton-regulatory complex protein END3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=END3 PE=2 SV=1 3 395 9.0E-102
sp|Q6BY77|END3_DEBHA Actin cytoskeleton-regulatory complex protein END3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=END3 PE=3 SV=2 3 393 6.0E-100
sp|A5DXI9|END3_LODEL Actin cytoskeleton-regulatory complex protein END3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=END3 PE=3 SV=1 3 359 3.0E-92
sp|Q9USZ7|END3_SCHPO Actin cytoskeleton-regulatory complex protein end3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=end3 PE=3 SV=1 5 393 1.0E-77
sp|Q755V2|END3_ASHGO Actin cytoskeleton-regulatory complex protein END3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=END3 PE=3 SV=2 3 395 9.0E-57
sp|Q6CTM9|END3_KLULA Actin cytoskeleton-regulatory complex protein END3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=END3 PE=3 SV=1 3 393 6.0E-56
sp|A7TEE6|END3_VANPO Actin cytoskeleton-regulatory complex protein END3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=END3 PE=3 SV=1 3 393 2.0E-45
sp|P39013|END3_YEAST Actin cytoskeleton-regulatory complex protein END3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=END3 PE=1 SV=1 3 391 1.0E-44
sp|A6ZRZ6|END3_YEAS7 Actin cytoskeleton-regulatory complex protein END3 OS=Saccharomyces cerevisiae (strain YJM789) GN=END3 PE=3 SV=1 3 391 3.0E-44
sp|Q6FP98|END3_CANGA Actin cytoskeleton-regulatory complex protein END3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=END3 PE=3 SV=1 3 391 1.0E-36
sp|P42566|EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens GN=EPS15 PE=1 SV=2 1 228 5.0E-20
sp|P42567|EPS15_MOUSE Epidermal growth factor receptor substrate 15 OS=Mus musculus GN=Eps15 PE=1 SV=1 1 226 1.0E-19
sp|Q9UBC2|EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens GN=EPS15L1 PE=1 SV=1 2 225 2.0E-13
sp|Q75AA0|PAN1_ASHGO Actin cytoskeleton-regulatory complex protein PAN1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAN1 PE=3 SV=2 4 96 3.0E-13
sp|B2AWS3|PAN1_PODAN Actin cytoskeleton-regulatory complex protein PAN1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAN1 PE=3 SV=1 26 103 2.0E-12
sp|A5DP36|PAN1_PICGU Actin cytoskeleton-regulatory complex protein PAN1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAN1 PE=3 SV=2 5 100 1.0E-11
sp|A4R8N4|PAN1_MAGO7 Actin cytoskeleton-regulatory complex protein PAN1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN1 PE=3 SV=2 26 103 4.0E-11
sp|Q7SAT8|PAN1_NEUCR Actin cytoskeleton-regulatory complex protein pan-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pan-1 PE=3 SV=1 26 100 5.0E-11
sp|Q0CPW4|PAN1_ASPTN Actin cytoskeleton-regulatory complex protein pan1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pan1 PE=3 SV=2 26 100 6.0E-11
sp|Q6BNL1|PAN1_DEBHA Actin cytoskeleton-regulatory complex protein PAN1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN1 PE=3 SV=2 5 100 7.0E-11
sp|A2R180|PAN1_ASPNC Actin cytoskeleton-regulatory complex protein pan1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pan1 PE=3 SV=1 26 100 7.0E-11
sp|P42566|EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens GN=EPS15 PE=1 SV=2 21 225 8.0E-11
sp|Q2H922|PAN1_CHAGB Actin cytoskeleton-regulatory complex protein PAN1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN1 PE=3 SV=1 26 96 9.0E-11
sp|Q2UDY8|PAN1_ASPOR Actin cytoskeleton-regulatory complex protein pan1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pan1 PE=3 SV=1 26 100 1.0E-10
sp|A1CD74|PAN1_ASPCL Actin cytoskeleton-regulatory complex protein pan1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pan1 PE=3 SV=1 26 100 1.0E-10
sp|B0YC95|PAN1_ASPFC Actin cytoskeleton-regulatory complex protein pan1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pan1 PE=3 SV=1 26 100 1.0E-10
sp|A1DC51|PAN1_NEOFI Actin cytoskeleton-regulatory complex protein pan1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pan1 PE=3 SV=1 26 100 1.0E-10
sp|Q6CQX9|PAN1_KLULA Actin cytoskeleton-regulatory complex protein PAN1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN1 PE=3 SV=1 5 96 1.0E-10
sp|Q4WG58|PAN1_ASPFU Actin cytoskeleton-regulatory complex protein pan1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pan1 PE=3 SV=1 26 100 2.0E-10
sp|A6S9N4|PAN1_BOTFB Actin cytoskeleton-regulatory complex protein pan1 OS=Botryotinia fuckeliana (strain B05.10) GN=pan1 PE=3 SV=1 14 96 3.0E-10
sp|Q5B5B0|PAN1_EMENI Actin cytoskeleton-regulatory complex protein pan1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pan1 PE=3 SV=1 26 100 5.0E-10
sp|A7EKZ0|PAN1_SCLS1 Actin cytoskeleton-regulatory complex protein pan1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pan1 PE=3 SV=1 1 96 5.0E-10
sp|A6R7X5|PAN1_AJECN Actin cytoskeleton-regulatory complex protein PAN1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=PAN1 PE=3 SV=1 26 96 6.0E-10
sp|Q54KI4|EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum GN=eps15 PE=1 SV=1 5 208 6.0E-10
sp|P32521|PAN1_YEAST Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN1 PE=1 SV=2 4 100 1.0E-09
sp|Q1DQC1|PAN1_COCIM Actin cytoskeleton-regulatory complex protein PAN1 OS=Coccidioides immitis (strain RS) GN=PAN1 PE=3 SV=1 26 100 1.0E-09
sp|Q6FPQ7|PAN1_CANGA Actin cytoskeleton-regulatory complex protein PAN1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAN1 PE=3 SV=1 5 100 2.0E-09
sp|Q60902|EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus GN=Eps15l1 PE=1 SV=3 5 80 3.0E-09
sp|A3LN86|PAN1_PICST Actin cytoskeleton-regulatory complex protein PAN1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN1 PE=3 SV=2 26 100 2.0E-08
sp|Q6C908|PAN1_YARLI Actin cytoskeleton-regulatory complex protein PAN1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAN1 PE=3 SV=1 5 100 3.0E-08
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 24 96 3.0E-08
sp|A7TSV7|PAN1_VANPO Actin cytoskeleton-regulatory complex protein PAN1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PAN1 PE=3 SV=1 5 100 4.0E-08
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 24 96 5.0E-08
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 24 96 6.0E-08
sp|Q9UBC2|EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens GN=EPS15L1 PE=1 SV=1 11 230 6.0E-08
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 27 96 7.0E-08
sp|A6ZVS5|PAN1_YEAS7 Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PAN1 PE=3 SV=2 36 100 8.0E-08
sp|Q6FPQ7|PAN1_CANGA Actin cytoskeleton-regulatory complex protein PAN1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAN1 PE=3 SV=1 5 80 2.0E-07
sp|Q9HGL2|YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.10c PE=3 SV=1 3 222 2.0E-07
sp|P42567|EPS15_MOUSE Epidermal growth factor receptor substrate 15 OS=Mus musculus GN=Eps15 PE=1 SV=1 32 225 4.0E-07
sp|Q6CQX9|PAN1_KLULA Actin cytoskeleton-regulatory complex protein PAN1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN1 PE=3 SV=1 21 131 5.0E-07
sp|Q9H4M9|EHD1_HUMAN EH domain-containing protein 1 OS=Homo sapiens GN=EHD1 PE=1 SV=2 5 97 7.0E-07
sp|Q5RBP4|EHD1_PONAB EH domain-containing protein 1 OS=Pongo abelii GN=EHD1 PE=2 SV=1 5 97 7.0E-07
sp|A5DVD6|PAN1_LODEL Actin cytoskeleton-regulatory complex protein PAN1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN1 PE=3 SV=1 5 96 7.0E-07
sp|P32521|PAN1_YEAST Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN1 PE=1 SV=2 21 80 8.0E-07
sp|A6ZVS5|PAN1_YEAS7 Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PAN1 PE=3 SV=2 21 80 8.0E-07
sp|Q5E9R3|EHD1_BOVIN EH domain-containing protein 1 OS=Bos taurus GN=EHD1 PE=1 SV=1 5 97 9.0E-07
sp|Q641Z6|EHD1_RAT EH domain-containing protein 1 OS=Rattus norvegicus GN=Ehd1 PE=1 SV=1 5 97 9.0E-07
sp|Q9WVK4|EHD1_MOUSE EH domain-containing protein 1 OS=Mus musculus GN=Ehd1 PE=1 SV=1 5 97 9.0E-07
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 26 89 1.0E-06
sp|A7TSV7|PAN1_VANPO Actin cytoskeleton-regulatory complex protein PAN1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PAN1 PE=3 SV=1 5 80 1.0E-06
sp|Q5B5B0|PAN1_EMENI Actin cytoskeleton-regulatory complex protein pan1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pan1 PE=3 SV=1 5 92 2.0E-06
sp|Q4WG58|PAN1_ASPFU Actin cytoskeleton-regulatory complex protein pan1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pan1 PE=3 SV=1 5 92 4.0E-06
sp|Q8BH64|EHD2_MOUSE EH domain-containing protein 2 OS=Mus musculus GN=Ehd2 PE=1 SV=1 5 97 4.0E-06
sp|Q4V8H8|EHD2_RAT EH domain-containing protein 2 OS=Rattus norvegicus GN=Ehd2 PE=1 SV=1 5 97 4.0E-06
sp|Q9NZN4|EHD2_HUMAN EH domain-containing protein 2 OS=Homo sapiens GN=EHD2 PE=1 SV=2 5 97 4.0E-06
sp|B0YC95|PAN1_ASPFC Actin cytoskeleton-regulatory complex protein pan1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pan1 PE=3 SV=1 5 92 5.0E-06
sp|Q9HGL2|YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.10c PE=3 SV=1 27 73 8.0E-06
sp|Q10172|PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pan1 PE=1 SV=1 1 103 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007015 actin filament organization Yes
GO:0006897 endocytosis Yes
GO:0005509 calcium ion binding Yes
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0016043 cellular component organization No
GO:0051179 localization No
GO:0006810 transport No
GO:0046872 metal ion binding No
GO:0051234 establishment of localization No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0097435 supramolecular fiber organization No
GO:0043167 ion binding No
GO:0009987 cellular process No
GO:0016192 vesicle-mediated transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4705
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2395 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2697
Ophiocordyceps camponoti-floridani Ophcf2|04076
Ophiocordyceps camponoti-rufipedis Ophun1|4776
Ophiocordyceps kimflemingae Ophio5|5426
Ophiocordyceps subramaniannii Hirsu2|9902

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2395
MPPKIEAKEVETYWNIFADRTGGSQFLTGEQAAPVLKNSGLRDDQLERVWDLADVDNDGNLDFEEFCVAMRVIFD
ILNGEYTDVPKTLPDWLVPESKAHLVQASRAITGKQAQFEHVDDDSDDQGLKDGFDWYMSPQDKSKYESIYQENR
DMRGEISFNSLEDLYASLDVPDTDVRSAWNLVNPSARQTINKDASLAFLHMLNNRHEGFRIPRTVPASLRSSFER
NQIDYQLGSQRTGTASRWAAKADDSTSTGRKAKFGDQYLTRLGRSGFKASGTDFSTEKTEDWEEVRLKRQLQDLE
AKMQKVEEIAARRQGGKRDSRPALVKRELDQLLDYKRRQLRDLEEGTGKAAVGGSLKSVSEDLQTIREQVEGLES
HLRSRQQVLDDLRQQVEAEKA*
Coding >OphauG2|2395
ATGCCCCCAAAGATCGAGGCCAAAGAGGTTGAAACATATTGGAACATATTCGCCGACCGCACTGGCGGCTCTCAA
TTCCTCACGGGCGAGCAGGCTGCTCCAGTGCTCAAGAATAGCGGCTTGCGAGACGACCAACTGGAGCGGGTATGG
GATCTGGCCGATGTCGACAACGATGGCAACCTCGATTTTGAAGAGTTTTGTGTTGCCATGCGAGTCATCTTTGAC
ATACTCAACGGAGAATATACCGATGTTCCCAAGACACTCCCAGACTGGCTGGTTCCCGAATCCAAAGCTCATCTA
GTGCAGGCCAGTCGCGCGATTACGGGCAAACAAGCACAGTTTGAGCACGTTGATGATGACTCGGATGATCAAGGG
CTCAAGGATGGCTTCGATTGGTATATGAGCCCGCAAGACAAGTCCAAGTACGAGTCGATATATCAGGAGAACCGA
GATATGCGAGGGGAAATTTCATTTAATTCCCTCGAGGATTTGTACGCGTCGCTCGACGTTCCAGACACCGACGTT
CGCTCAGCCTGGAACTTGGTCAACCCTTCGGCACGGCAAACCATCAACAAGGATGCCAGTCTTGCCTTTTTACAC
ATGCTGAATAACCGCCACGAGGGCTTCCGCATCCCACGTACCGTACCTGCTTCTCTACGGTCGAGCTTTGAAAGA
AACCAAATAGATTACCAGCTTGGTTCTCAGCGCACAGGGACTGCGTCGCGATGGGCAGCAAAAGCCGACGATTCG
ACATCAACAGGGCGCAAAGCAAAGTTTGGCGATCAGTATCTCACCCGTCTCGGCCGCAGCGGCTTCAAGGCCTCA
GGTACCGACTTCTCCACCGAAAAGACGGAAGACTGGGAGGAAGTACGTCTGAAGCGCCAACTGCAAGACCTAGAG
GCCAAGATGCAAAAGGTTGAGGAGATTGCTGCGCGCCGTCAGGGAGGCAAGCGAGACTCGAGGCCTGCGCTGGTC
AAAAGAGAGCTCGACCAGTTGCTCGACTATAAACGTCGGCAGCTGCGGGATCTGGAAGAGGGCACAGGCAAAGCA
GCTGTAGGTGGGAGTCTAAAGAGCGTGTCTGAAGACTTGCAGACTATCCGCGAGCAAGTTGAGGGCCTGGAGTCT
CATTTGCGATCAAGACAGCAAGTGCTTGATGACCTGCGGCAGCAAGTCGAGGCCGAGAAGGCGTGA
Transcript >OphauG2|2395
ATGCCCCCAAAGATCGAGGCCAAAGAGGTTGAAACATATTGGAACATATTCGCCGACCGCACTGGCGGCTCTCAA
TTCCTCACGGGCGAGCAGGCTGCTCCAGTGCTCAAGAATAGCGGCTTGCGAGACGACCAACTGGAGCGGGTATGG
GATCTGGCCGATGTCGACAACGATGGCAACCTCGATTTTGAAGAGTTTTGTGTTGCCATGCGAGTCATCTTTGAC
ATACTCAACGGAGAATATACCGATGTTCCCAAGACACTCCCAGACTGGCTGGTTCCCGAATCCAAAGCTCATCTA
GTGCAGGCCAGTCGCGCGATTACGGGCAAACAAGCACAGTTTGAGCACGTTGATGATGACTCGGATGATCAAGGG
CTCAAGGATGGCTTCGATTGGTATATGAGCCCGCAAGACAAGTCCAAGTACGAGTCGATATATCAGGAGAACCGA
GATATGCGAGGGGAAATTTCATTTAATTCCCTCGAGGATTTGTACGCGTCGCTCGACGTTCCAGACACCGACGTT
CGCTCAGCCTGGAACTTGGTCAACCCTTCGGCACGGCAAACCATCAACAAGGATGCCAGTCTTGCCTTTTTACAC
ATGCTGAATAACCGCCACGAGGGCTTCCGCATCCCACGTACCGTACCTGCTTCTCTACGGTCGAGCTTTGAAAGA
AACCAAATAGATTACCAGCTTGGTTCTCAGCGCACAGGGACTGCGTCGCGATGGGCAGCAAAAGCCGACGATTCG
ACATCAACAGGGCGCAAAGCAAAGTTTGGCGATCAGTATCTCACCCGTCTCGGCCGCAGCGGCTTCAAGGCCTCA
GGTACCGACTTCTCCACCGAAAAGACGGAAGACTGGGAGGAAGTACGTCTGAAGCGCCAACTGCAAGACCTAGAG
GCCAAGATGCAAAAGGTTGAGGAGATTGCTGCGCGCCGTCAGGGAGGCAAGCGAGACTCGAGGCCTGCGCTGGTC
AAAAGAGAGCTCGACCAGTTGCTCGACTATAAACGTCGGCAGCTGCGGGATCTGGAAGAGGGCACAGGCAAAGCA
GCTGTAGGTGGGAGTCTAAAGAGCGTGTCTGAAGACTTGCAGACTATCCGCGAGCAAGTTGAGGGCCTGGAGTCT
CATTTGCGATCAAGACAGCAAGTGCTTGATGACCTGCGGCAGCAAGTCGAGGCCGAGAAGGCGTGA
Gene >OphauG2|2395
ATGCCCCCAAAGATCGAGGCCAAAGAGGTTGAAACATATTGGAACATATTCGCCGACCGCACTGGCGGCTCTCAA
TTCCTCACGGGCGAGCAGGCTGCTCCAGTGCTCAAGAATAGCGGCTTGCGAGACGACCAACTGGAGCGGGTATGG
GATCTGGCCGATGTCGACAACGATGGCAACCTCGATTTTGAAGAGTTTTGTGTTGCCATGCGAGTCATCTTTGAC
ATACTCAACGGAGTAAGATGGTCATCTAACAACGCCCTCTAACTCCCAATGGACTAGCCAGCTCACTGTCTACCC
GCGTAGGAATATACCGATGTTCCCAAGACACTCCCAGACTGGCTGGTTCCCGAATCCAAAGCTCATCTAGTGCAG
GCCAGTCGCGCGATTACGGGCAAACAAGCACAGTTTGAGCACGTTGATGATGACTCGGATGATCAAGGGCTCAAG
GATGGCTTCGATTGGTATATGAGCCCGCAAGACAAGTCCAAGTACGAGTCGATATATCAGGAGAACCGAGATATG
CGAGGGGAAATTTCATGCAAGTTATTGCTTTTCCTTTCCACATCATTTTCTTCTTTGCTGCTATGTGTATGCTGA
CGCTCCGCTTGATACTAGTTAATTCCCTCGAGGATTTGTACGCGTCGCTCGACGTTCCAGACACCGACGTTCGCT
CAGCCTGGAACTTGGTCAACCCTTCGGCACGGCAAACCATCAACAAGGATGCCAGTCTTGCCTTTTTACACATGC
TGAATAACCGCCACGAGGGCTTCCGCATCCCACGTACCGTACCTGCTTCTCTACGGTCGAGCTTTGAAAGAAACC
AAATAGATTACCAGCTTGGTTCTCAGCGCACAGGGACTGCGTCGCGATGGGCAGCAAAAGCCGACGATTCGACAT
CAACAGGGCGCAAAGCAAAGTTTGGCGATCAGTATCTCACCCGTCTCGGCCGCAGCGGCTTCAAGGCCTCAGGTA
CCGACTTCTCCACCGAAAAGACGGAAGACTGGGAGGAAGTACGTCTGAAGCGCCAACTGCAAGACCTAGAGGCCA
AGATGCAAAAGGTTGAGGAGATTGCTGCGCGCCGTCAGGGAGGCAAGCGAGACTCGAGGCCTGCGCTGGTCAAAA
GAGAGCTCGACCAGTTGCTCGACTATAAACGTCGGCAGCTGCGGGATCTGGAAGAGGGCACAGGCAAAGCAGCTG
TAGGTGGGAGTCTAAAGAGCGTGTCTGAAGACTTGCAGACTATCCGCGAGCAAGTTGAGGGCCTGGAGTCTCATT
TGCGATCAAGACAGCAAGTGCTTGATGACCTGCGGCAGCAAGTCGAGGCCGAGAAGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail