Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2392
Gene name
LocationContig_186:7519..8466
Strand+
Gene length (bp)947
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08784 RPA_C Replication protein A C terminal 3.2E-15 165 266
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 3.2E-09 75 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92373|RFA2_SCHPO Replication factor A protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssb2 PE=1 SV=1 44 268 2.0E-41
sp|Q6DFS2|RFA2_XENTR Replication protein A 32 kDa subunit OS=Xenopus tropicalis GN=rpa2 PE=2 SV=1 18 268 7.0E-28
sp|P26754|RFA2_YEAST Replication factor A protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFA2 PE=1 SV=1 1 271 1.0E-27
sp|Q6IP18|RFA2A_XENLA Replication protein A 32 kDa subunit-A OS=Xenopus laevis GN=rpa2-a PE=1 SV=1 18 268 2.0E-26
sp|Q62193|RFA2_MOUSE Replication protein A 32 kDa subunit OS=Mus musculus GN=Rpa2 PE=1 SV=1 2 266 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92373|RFA2_SCHPO Replication factor A protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssb2 PE=1 SV=1 44 268 2.0E-41
sp|Q6DFS2|RFA2_XENTR Replication protein A 32 kDa subunit OS=Xenopus tropicalis GN=rpa2 PE=2 SV=1 18 268 7.0E-28
sp|P26754|RFA2_YEAST Replication factor A protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFA2 PE=1 SV=1 1 271 1.0E-27
sp|Q6IP18|RFA2A_XENLA Replication protein A 32 kDa subunit-A OS=Xenopus laevis GN=rpa2-a PE=1 SV=1 18 268 2.0E-26
sp|Q62193|RFA2_MOUSE Replication protein A 32 kDa subunit OS=Mus musculus GN=Rpa2 PE=1 SV=1 2 266 4.0E-26
sp|Q63528|RFA2_RAT Replication protein A 32 kDa subunit OS=Rattus norvegicus GN=Rpa2 PE=2 SV=2 12 266 7.0E-26
sp|Q8LFJ8|RFA2B_ARATH Replication protein A 32 kDa subunit B OS=Arabidopsis thaliana GN=RPA2B PE=2 SV=1 16 268 9.0E-26
sp|Q5RC43|RFA2_PONAB Replication protein A 32 kDa subunit OS=Pongo abelii GN=RPA2 PE=2 SV=1 18 266 2.0E-24
sp|P15927|RFA2_HUMAN Replication protein A 32 kDa subunit OS=Homo sapiens GN=RPA2 PE=1 SV=1 18 266 2.0E-24
sp|A1L2H9|RFA2B_XENLA Replication protein A 32 kDa subunit-B OS=Xenopus laevis GN=rpa2-b PE=2 SV=1 18 268 3.0E-24
sp|Q6K9U2|RFA2A_ORYSJ Replication protein A 32 kDa subunit A OS=Oryza sativa subsp. japonica GN=RPA2A PE=1 SV=1 32 268 5.0E-22
sp|Q6H7J5|RFA2B_ORYSJ Replication protein A 32 kDa subunit B OS=Oryza sativa subsp. japonica GN=RPA2B PE=1 SV=1 37 203 8.0E-22
sp|Q9ZQ19|RFA2A_ARATH Replication protein A 32 kDa subunit A OS=Arabidopsis thaliana GN=RPA2A PE=1 SV=2 10 272 2.0E-21
sp|Q23697|RFA2_CRIFA Replication protein A 28 kDa subunit OS=Crithidia fasciculata GN=RPA2 PE=3 SV=1 44 170 1.0E-13
sp|Q13156|RFA4_HUMAN Replication protein A 30 kDa subunit OS=Homo sapiens GN=RPA4 PE=1 SV=2 2 268 2.0E-12
sp|Q5Z8L1|RFA2C_ORYSJ Replication protein A 32 kDa subunit C OS=Oryza sativa subsp. japonica GN=RPA2C PE=1 SV=2 64 166 4.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4707
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2392 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2700
Ophiocordyceps camponoti-floridani Ophcf2|04079
Ophiocordyceps camponoti-rufipedis Ophun1|4773
Ophiocordyceps kimflemingae Ophio5|3378
Ophiocordyceps subramaniannii Hirsu2|9905

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2392
MSAYGAYFKTSYGAQGGEDSGGFFAGGSQQGSQSGGKSYQDESLRPVTIKQILEAEEPYSGADFRIDGSVVTQIT
IVGQVRNISPQPTNITFKIDDGTGQVEVKKWIDADKQDDADPGFELDSYVRVWGRLKSFSNKRHVGAHVIRHITD
FNEINYHLLEATYVHLFYTRSTPADVAAGANADSMFVDGDRGNMAAATSAGSSKLSACGPAARKMYTFMEKASGG
GNEGIHLNHICSSTGMSVRDALTAADELLGNGLIYTTVDDETWALLEY*
Coding >OphauG2|2392
ATGTCAGCATACGGCGCGTATTTCAAGACGTCTTACGGCGCTCAGGGCGGCGAGGACTCGGGCGGCTTCTTCGCC
GGCGGCTCCCAGCAGGGCAGCCAAAGCGGAGGCAAGTCCTACCAAGACGAGTCGCTGCGGCCCGTCACCATCAAA
CAGATTCTCGAAGCCGAAGAGCCATATTCAGGCGCAGATTTCCGCATCGACGGCTCTGTTGTGACGCAAATCACC
ATTGTGGGCCAAGTCCGCAACATTAGTCCGCAGCCCACAAACATCACCTTCAAAATCGACGATGGCACTGGGCAG
GTCGAGGTCAAGAAGTGGATAGATGCCGACAAGCAAGACGATGCCGACCCGGGATTCGAACTCGACTCATATGTC
CGCGTCTGGGGTCGCCTCAAGTCCTTCTCCAACAAACGCCATGTTGGCGCTCACGTCATCCGCCACATTACCGAC
TTCAACGAGATCAACTACCACTTGCTCGAGGCCACCTACGTCCACCTCTTTTACACTCGCAGCACTCCCGCTGAC
GTTGCGGCTGGTGCTAATGCCGACAGCATGTTCGTCGACGGCGACCGTGGCAACATGGCTGCAGCCACCAGCGCT
GGGTCAAGCAAACTCTCAGCCTGCGGCCCCGCAGCGAGAAAAATGTACACCTTTATGGAGAAGGCGTCGGGTGGT
GGTAACGAGGGAATCCACCTAAACCACATCTGCAGCTCGACAGGCATGTCTGTGCGAGATGCTCTTACAGCTGCT
GACGAATTGCTCGGCAACGGTCTCATTTACACAACCGTTGATGATGAAACTTGGGCTCTTTTGGAGTACTAG
Transcript >OphauG2|2392
ATGTCAGCATACGGCGCGTATTTCAAGACGTCTTACGGCGCTCAGGGCGGCGAGGACTCGGGCGGCTTCTTCGCC
GGCGGCTCCCAGCAGGGCAGCCAAAGCGGAGGCAAGTCCTACCAAGACGAGTCGCTGCGGCCCGTCACCATCAAA
CAGATTCTCGAAGCCGAAGAGCCATATTCAGGCGCAGATTTCCGCATCGACGGCTCTGTTGTGACGCAAATCACC
ATTGTGGGCCAAGTCCGCAACATTAGTCCGCAGCCCACAAACATCACCTTCAAAATCGACGATGGCACTGGGCAG
GTCGAGGTCAAGAAGTGGATAGATGCCGACAAGCAAGACGATGCCGACCCGGGATTCGAACTCGACTCATATGTC
CGCGTCTGGGGTCGCCTCAAGTCCTTCTCCAACAAACGCCATGTTGGCGCTCACGTCATCCGCCACATTACCGAC
TTCAACGAGATCAACTACCACTTGCTCGAGGCCACCTACGTCCACCTCTTTTACACTCGCAGCACTCCCGCTGAC
GTTGCGGCTGGTGCTAATGCCGACAGCATGTTCGTCGACGGCGACCGTGGCAACATGGCTGCAGCCACCAGCGCT
GGGTCAAGCAAACTCTCAGCCTGCGGCCCCGCAGCGAGAAAAATGTACACCTTTATGGAGAAGGCGTCGGGTGGT
GGTAACGAGGGAATCCACCTAAACCACATCTGCAGCTCGACAGGCATGTCTGTGCGAGATGCTCTTACAGCTGCT
GACGAATTGCTCGGCAACGGTCTCATTTACACAACCGTTGATGATGAAACTTGGGCTCTTTTGGAGTACTAG
Gene >OphauG2|2392
ATGTGTAAGACAAGCCGCTCTTTTGCAGGGAACCAGGCACTGATTTGGGTCGATTCATATAGCAGCATACGGCGC
GTATTTCAAGACGTCTTACGGCGCTCAGGGCGGCGAGGACTCGGGCGGCTTCTTCGCCGGCGGCTCCCAGCAGGG
CAGCCAAAGCGGAGGCAAGGTGTGACTTGGCGTCTCTCATCCTTCAACTACCGGTTGGCAACGCCGACTGACAAA
TCATGGTGCAGTCCTACCAAGACGAGTCGCTGCGGCCCGTCACCATCAAACAGATTCTCGAAGCCGAAGAGCCAT
ATTCAGGCGCAGATTTCCGCATCGACGGCTCTGTTGTGACGCAAATCACCATTGTGGGCCAAGTCCGCAACATTA
GTCCGCAGCCCACAAACATCACCTTCAAAATCGACGATGGCACTGGGCAGGTCGAGGTCAAGAAGTGGATAGATG
CCGACAAGCAAGACGATGCCGACCCGGGATTCGAACTCGACTCATATGTCCGCGTCTGGGGTCGCCTCAAGTCCT
TCTCCAACAAACGCCATGTTGGCGCTCACGTCATCCGCCACATTACCGACTTCAACGAGATCAACTACCACTTGC
TCGAGGCCACCTACGTCCACCTCTTTTACACTCGCAGCACTCCCGCTGACGTTGCGGCTGGTGCTAATGCCGACA
GCATGTTCGTCGACGGCGACCGTGGCAACATGGCTGCAGCCACCAGCGCTGGGTCAAGCAAACTCTCAGCCTGCG
GCCCCGCAGCGAGAAAAATGTACACCTTTATGGAGAAGGCGTCGGGTGGTGGTAACGAGGGAATCCACCTAAACC
ACATCTGCAGCTCGACAGGCATGTCTGTGCGAGATGCTCTTACAGCTGCTGACGAATTGCTCGGCAACGGTCTCA
TTTACACAACCGTTGATGATGAAACTTGGGCTCTTTTGGAGTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail