Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2380
Gene name
LocationContig_185:14128..16178
Strand-
Gene length (bp)2050
Transcript length (bp)1851
Coding sequence length (bp)1851
Protein length (aa) 617

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04185 Phosphoesterase Phosphoesterase family 1.7E-73 24 396

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15713|PHLN_PSEAE Non-hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcN PE=3 SV=2 1 492 1.0E-65
sp|Q9RGS8|PHLN_BURPS Non-hemolytic phospholipase C OS=Burkholderia pseudomallei (strain K96243) GN=plcN PE=1 SV=2 9 438 1.0E-62
sp|P9WIB1|PHLC_MYCTU Phospholipase C 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcC PE=1 SV=1 3 437 3.0E-59
sp|P9WIB0|PHLC_MYCTO Phospholipase C 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcC PE=3 SV=1 3 437 3.0E-59
sp|P06200|PHLC_PSEAE Hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcH PE=3 SV=2 17 427 2.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15713|PHLN_PSEAE Non-hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcN PE=3 SV=2 1 492 1.0E-65
sp|Q9RGS8|PHLN_BURPS Non-hemolytic phospholipase C OS=Burkholderia pseudomallei (strain K96243) GN=plcN PE=1 SV=2 9 438 1.0E-62
sp|P9WIB1|PHLC_MYCTU Phospholipase C 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcC PE=1 SV=1 3 437 3.0E-59
sp|P9WIB0|PHLC_MYCTO Phospholipase C 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcC PE=3 SV=1 3 437 3.0E-59
sp|P06200|PHLC_PSEAE Hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcH PE=3 SV=2 17 427 2.0E-56
sp|P9WIA9|PHLD_MYCTU Phospholipase C 4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcD PE=3 SV=1 21 440 1.0E-52
sp|P9WIA8|PHLD_MYCTO Phospholipase C 4 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcD PE=3 SV=1 21 440 1.0E-52
sp|P0A5R9|PHLD_MYCBO Phospholipase C 4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=plcD PE=3 SV=1 21 440 1.0E-52
sp|P9WIB5|PHLA_MYCTU Phospholipase C 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcA PE=1 SV=1 21 433 2.0E-52
sp|P9WIB4|PHLA_MYCTO Phospholipase C 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcA PE=3 SV=1 21 433 2.0E-52
sp|P9WIB3|PHLB_MYCTU Phospholipase C 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcB PE=1 SV=1 21 438 2.0E-48
sp|P9WIB2|PHLB_MYCTO Phospholipase C 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcB PE=3 SV=1 21 438 2.0E-48
sp|Q8H965|NPC6_ARATH Non-specific phospholipase C6 OS=Arabidopsis thaliana GN=NPC6 PE=2 SV=1 4 382 6.0E-11
sp|Q9S816|NPC5_ARATH Non-specific phospholipase C5 OS=Arabidopsis thaliana GN=NPC5 PE=2 SV=1 24 383 2.0E-08
sp|O81020|NPC2_ARATH Non-specific phospholipase C2 OS=Arabidopsis thaliana GN=NPC2 PE=2 SV=1 1 383 3.0E-08
sp|Q9SRQ7|NPC4_ARATH Non-specific phospholipase C4 OS=Arabidopsis thaliana GN=NPC4 PE=1 SV=1 24 383 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2380
MRALSLWAAVTASRLGQAASLMDIDHVVLFMQENRAFDHYFGSMAGVRGFNDANLQLNDNVPVWKQVTSPALTRD
ADHVSPWHLNYLGGDWPAATQCMGAGSNSWYENHLAWNLGRNDHWAVNNTPWSIGFYKRQDVPTHWALAEGWIVG
DMYQESVVASTNPNRVSWISGSINAPGSPQRPDQGGNPYIDNNEVPGCEPGGFNCFPLKWTTAGELYEAAGVSWQ
VFQDEDNFDDNPYAWFEQFQHSKSTSSLYRRGFKGLSLNTFYDLAANGSLPEVSYIVGPMQLSEHPPYSPNDGAW
LQTQIAQAVINSPKYNKTALIVSYDETGGWFDHVNPFHAPDGTRGEWIDDPWGQVGHTFTGPGFRVPFYIISPFT
RNGGVYTGHADHSSQILFVEQWQAAKGRSVVTQEMPAWRRRNMGDLVDAFDFDHPDYSLPHLPVPPTPHKNALGQ
YDGSAHCQATHPHPRPPVPYTGPGAIQDMASVVEHGFKPVRGKLTEGRFLVLEADGFALANEAPQGLTLKPATAA
HQDERQRWTVHAVQLGGVEFALQSYADKRFVCRDSTLCLDKQQAVVFQIDFCSGKGYSLKAKHLDGFLAVNNGGL
WYQQTRAHWHVFSVSY*
Coding >OphauG2|2380
ATGAGGGCTCTGAGCCTCTGGGCCGCCGTCACGGCAAGCAGGCTGGGGCAGGCAGCCAGCCTCATGGACATTGAC
CACGTCGTGCTCTTCATGCAGGAGAACCGGGCGTTTGACCACTACTTTGGCAGCATGGCCGGGGTGCGCGGCTTC
AACGACGCCAATCTGCAACTCAACGACAATGTGCCCGTGTGGAAGCAGGTGACGTCGCCAGCGCTGACTCGCGAC
GCTGACCATGTCTCGCCGTGGCATCTCAACTACCTGGGCGGCGACTGGCCCGCGGCAACGCAGTGCATGGGCGCG
GGGAGCAACAGCTGGTACGAAAACCACTTGGCGTGGAACCTGGGCAGAAACGACCACTGGGCTGTGAATAATACG
CCATGGAGCATTGGCTTTTACAAGAGACAGGACGTGCCGACCCATTGGGCTCTGGCCGAGGGCTGGATCGTCGGC
GACATGTATCAGGAATCCGTGGTTGCTTCCACAAACCCCAACCGCGTCAGCTGGATCTCTGGCTCCATCAATGCC
CCCGGCTCGCCTCAGCGGCCCGACCAGGGCGGCAATCCCTACATTGACAACAACGAGGTTCCGGGCTGCGAGCCA
GGCGGCTTCAACTGCTTCCCGCTCAAGTGGACGACGGCGGGCGAGCTCTACGAAGCAGCAGGCGTCTCGTGGCAG
GTGTTTCAAGACGAGGACAACTTTGACGATAACCCGTATGCCTGGTTTGAGCAGTTTCAACACTCCAAAAGCACC
TCGTCGCTGTATAGGCGAGGCTTCAAGGGGCTCTCGCTAAACACGTTTTACGACTTGGCTGCCAATGGGTCGCTG
CCTGAGGTGTCGTACATTGTCGGGCCCATGCAGCTGTCGGAGCATCCGCCTTACTCGCCCAACGACGGGGCCTGG
CTGCAGACGCAGATTGCTCAGGCAGTCATCAACTCGCCCAAGTATAACAAGACGGCGCTTATTGTTTCCTACGAC
GAGACGGGCGGCTGGTTCGACCACGTGAATCCGTTCCACGCCCCCGACGGGACGCGGGGAGAGTGGATTGACGAT
CCCTGGGGCCAGGTAGGCCATACGTTTACCGGCCCTGGATTCCGCGTCCCATTCTACATCATCTCGCCCTTTACG
CGCAACGGCGGAGTCTACACCGGGCATGCCGACCACTCTTCGCAAATCCTCTTTGTCGAGCAGTGGCAGGCCGCC
AAGGGCCGCAGCGTCGTGACACAGGAAATGCCGGCTTGGCGGCGGCGCAACATGGGCGACCTGGTCGACGCCTTT
GACTTTGACCACCCCGACTACTCCCTGCCCCATCTCCCTGTGCCCCCAACCCCCCACAAGAATGCCCTGGGCCAG
TACGACGGATCGGCACACTGCCAAGCCACCCACCCCCATCCCCGGCCGCCCGTGCCGTACACAGGGCCTGGAGCC
ATCCAAGACATGGCTTCCGTCGTGGAGCACGGCTTCAAGCCCGTGCGCGGAAAACTCACCGAGGGGCGCTTCCTT
GTCCTCGAGGCAGATGGCTTTGCCCTGGCCAATGAGGCGCCGCAAGGGTTGACGCTGAAGCCAGCCACGGCTGCT
CACCAAGACGAGCGCCAGCGCTGGACGGTCCATGCTGTGCAGCTCGGCGGCGTAGAATTCGCTCTGCAAAGCTAC
GCGGACAAACGCTTCGTATGCCGTGACTCTACCCTTTGTCTCGACAAGCAGCAAGCTGTCGTGTTTCAGATTGAC
TTTTGCTCCGGCAAGGGATACTCTCTCAAGGCAAAGCATCTCGATGGCTTCCTGGCCGTCAACAACGGCGGCTTG
TGGTATCAGCAGACTCGGGCTCATTGGCATGTATTTAGTGTAAGCTATTGA
Transcript >OphauG2|2380
ATGAGGGCTCTGAGCCTCTGGGCCGCCGTCACGGCAAGCAGGCTGGGGCAGGCAGCCAGCCTCATGGACATTGAC
CACGTCGTGCTCTTCATGCAGGAGAACCGGGCGTTTGACCACTACTTTGGCAGCATGGCCGGGGTGCGCGGCTTC
AACGACGCCAATCTGCAACTCAACGACAATGTGCCCGTGTGGAAGCAGGTGACGTCGCCAGCGCTGACTCGCGAC
GCTGACCATGTCTCGCCGTGGCATCTCAACTACCTGGGCGGCGACTGGCCCGCGGCAACGCAGTGCATGGGCGCG
GGGAGCAACAGCTGGTACGAAAACCACTTGGCGTGGAACCTGGGCAGAAACGACCACTGGGCTGTGAATAATACG
CCATGGAGCATTGGCTTTTACAAGAGACAGGACGTGCCGACCCATTGGGCTCTGGCCGAGGGCTGGATCGTCGGC
GACATGTATCAGGAATCCGTGGTTGCTTCCACAAACCCCAACCGCGTCAGCTGGATCTCTGGCTCCATCAATGCC
CCCGGCTCGCCTCAGCGGCCCGACCAGGGCGGCAATCCCTACATTGACAACAACGAGGTTCCGGGCTGCGAGCCA
GGCGGCTTCAACTGCTTCCCGCTCAAGTGGACGACGGCGGGCGAGCTCTACGAAGCAGCAGGCGTCTCGTGGCAG
GTGTTTCAAGACGAGGACAACTTTGACGATAACCCGTATGCCTGGTTTGAGCAGTTTCAACACTCCAAAAGCACC
TCGTCGCTGTATAGGCGAGGCTTCAAGGGGCTCTCGCTAAACACGTTTTACGACTTGGCTGCCAATGGGTCGCTG
CCTGAGGTGTCGTACATTGTCGGGCCCATGCAGCTGTCGGAGCATCCGCCTTACTCGCCCAACGACGGGGCCTGG
CTGCAGACGCAGATTGCTCAGGCAGTCATCAACTCGCCCAAGTATAACAAGACGGCGCTTATTGTTTCCTACGAC
GAGACGGGCGGCTGGTTCGACCACGTGAATCCGTTCCACGCCCCCGACGGGACGCGGGGAGAGTGGATTGACGAT
CCCTGGGGCCAGGTAGGCCATACGTTTACCGGCCCTGGATTCCGCGTCCCATTCTACATCATCTCGCCCTTTACG
CGCAACGGCGGAGTCTACACCGGGCATGCCGACCACTCTTCGCAAATCCTCTTTGTCGAGCAGTGGCAGGCCGCC
AAGGGCCGCAGCGTCGTGACACAGGAAATGCCGGCTTGGCGGCGGCGCAACATGGGCGACCTGGTCGACGCCTTT
GACTTTGACCACCCCGACTACTCCCTGCCCCATCTCCCTGTGCCCCCAACCCCCCACAAGAATGCCCTGGGCCAG
TACGACGGATCGGCACACTGCCAAGCCACCCACCCCCATCCCCGGCCGCCCGTGCCGTACACAGGGCCTGGAGCC
ATCCAAGACATGGCTTCCGTCGTGGAGCACGGCTTCAAGCCCGTGCGCGGAAAACTCACCGAGGGGCGCTTCCTT
GTCCTCGAGGCAGATGGCTTTGCCCTGGCCAATGAGGCGCCGCAAGGGTTGACGCTGAAGCCAGCCACGGCTGCT
CACCAAGACGAGCGCCAGCGCTGGACGGTCCATGCTGTGCAGCTCGGCGGCGTAGAATTCGCTCTGCAAAGCTAC
GCGGACAAACGCTTCGTATGCCGTGACTCTACCCTTTGTCTCGACAAGCAGCAAGCTGTCGTGTTTCAGATTGAC
TTTTGCTCCGGCAAGGGATACTCTCTCAAGGCAAAGCATCTCGATGGCTTCCTGGCCGTCAACAACGGCGGCTTG
TGGTATCAGCAGACTCGGGCTCATTGGCATGTATTTAGTGTAAGCTATTGA
Gene >OphauG2|2380
ATGAGGGCTCTGAGCCTCTGGGCCGCCGTCACGGCAAGCAGGCTGGGGCAGGCAGCCAGCCTCATGGACATTGAC
CACGTCGTGCTCTTCATGCAGGGTAAGAGGGAGAAGAAGCAAAAAAAAAAAAGAAGAAGAAAAAAGAAAAAAAAA
GAGAGGCGGCGCTTGTGATTGGCCTTGTTGTTAAGCGTTGAAAAGCCAACGGCTGGATTTAGAGAACCGGGCGTT
TGACCACTACTTTGGCAGCATGGCCGGGGTGCGCGGCTTCAACGACGCCAATCTGCAACTCAACGACAATGTGCC
CGTGTGGAAGCAGGTGACGTCGCCAGCGCTGACTCGCGACGCTGACCATGTCTCGCCGTGGCATCTCAACTACCT
GGGCGGCGACTGGCCCGCGGCAACGCAGTGCATGGGCGCGGGGAGCAACAGCTGGTACGAAAACCACTTGGCGTG
GAACCTGGGCAGAAACGACCACTGGGCTGTGAATAATACGCCATGGAGCATTGGCTTTTACAAGAGACAGGACGT
GCCGACCCATTGGGCTCTGGCCGAGGGCTGGATCGTCGGCGACATGTATCAGGTGCGTAGCGGCTGTATTTATTT
TTTTGATGTTTTATTTTAGAGTGTTGCCGTCGTTATTGGCCCCCTGACGGGCCTGGCCCAGGAATCCGTGGTTGC
TTCCACAAACCCCAACCGCGTCAGCTGGATCTCTGGCTCCATCAATGCCCCCGGCTCGCCTCAGCGGCCCGACCA
GGGCGGCAATCCCTACATTGACAACAACGAGGTTCCGGGCTGCGAGCCAGGCGGCTTCAACTGCTTCCCGCTCAA
GTGGACGACGGCGGGCGAGCTCTACGAAGCAGCAGGCGTCTCGTGGCAGGTGTTTCAAGACGAGGACAACTTTGA
CGATAACCCGTATGCCTGGTTTGAGCAGTTTCAACACTCCAAAAGCACCTCGTCGCTGTATAGGCGAGGCTTCAA
GGGGCTCTCGCTAAACACGTTTTACGACTTGGCTGCCAATGGGTCGCTGCCTGAGGTGTCGTACATTGTCGGGCC
CATGCAGCTGTCGGAGCATCCGCCTTACTCGCCCAACGACGGGGCCTGGCTGCAGACGCAGATTGCTCAGGCAGT
CATCAACTCGCCCAAGTATAACAAGACGGCGCTTATTGTTTCCTACGACGAGACGGGCGGCTGGTTCGACCACGT
GAATCCGTTCCACGCCCCCGACGGGACGCGGGGAGAGTGGATTGACGATCCCTGGGGCCAGGTAGGCCATACGTT
TACCGGCCCTGGATTCCGCGTCCCATTCTACATCATCTCGCCCTTTACGCGCAACGGCGGAGTCTACACCGGGCA
TGCCGACCACTCTTCGCAAATCCTCTTTGTCGAGCAGTGGCAGGCCGCCAAGGGCCGCAGCGTCGTGACACAGGA
AATGCCGGCTTGGCGGCGGCGCAACATGGGCGACCTGGTCGACGCCTTTGACTTTGACCACCCCGACTACTCCCT
GCCCCATCTCCCTGTGCCCCCAACCCCCCACAAGAATGCCCTGGGCCAGTACGACGGATCGGCACACTGCCAAGC
CACCCACCCCCATCCCCGGCCGCCCGTGCCGTACACAGGGCCTGGAGCCATCCAAGACATGGCTTCCGTCGTGGA
GCACGGCTTCAAGCCCGTGCGCGGAAAACTCACCGAGGGGCGCTTCCTTGTCCTCGAGGCAGATGGCTTTGCCCT
GGCCAATGAGGCGCCGCAAGGGTTGACGCTGAAGCCAGCCACGGCTGCTCACCAAGACGAGCGCCAGCGCTGGAC
GGTCCATGCTGTGCAGCTCGGCGGCGTAGAATTCGCTCTGCAAAGCTACGCGGACAAACGCTTCGTATGCCGTGA
CTCTACCCTTTGTCTCGACAAGCAGCAAGCTGTCGTGTTTCAGATTGACTTTTGCTCCGGCAAGGGATACTCTCT
CAAGGCAAAGCATCTCGATGGCTTCCTGGCCGTCAACAACGGCGGCTTGTGGTATCAGCAGACTCGGGCTCATTG
GCATGTATTTAGTGTAAGCTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail