Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|238
Gene name
LocationContig_1048:1216..3706
Strand+
Gene length (bp)2490
Transcript length (bp)2490
Coding sequence length (bp)2490
Protein length (aa) 830

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13812 PPR_3 Pentatricopeptide repeat domain 3.1E-05 554 606

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 411 745 2.0E-13
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 374 749 3.0E-10
sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 411 745 1.0E-09
sp|Q9MAG8|PPR79_ARATH Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 425 638 6.0E-09
sp|Q9FLL3|PP412_ARATH Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 421 686 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 411 745 2.0E-13
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 374 749 3.0E-10
sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 411 745 1.0E-09
sp|Q9MAG8|PPR79_ARATH Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 425 638 6.0E-09
sp|Q9FLL3|PP412_ARATH Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 421 686 1.0E-08
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 434 683 1.0E-08
sp|Q9SH60|PP103_ARATH Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 434 783 2.0E-08
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 349 687 2.0E-08
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 411 687 5.0E-08
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 431 602 5.0E-08
sp|Q8GZ63|PP397_ARATH Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 431 745 6.0E-08
sp|Q9LFQ4|PP383_ARATH Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 447 644 1.0E-07
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 398 745 2.0E-07
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 441 770 2.0E-07
sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 410 782 3.0E-07
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 434 746 8.0E-07
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 432 607 5.0E-06
sp|Q9LER0|PP381_ARATH Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 366 654 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|238
MAARCPAACVRLSSTSSDAAPLVDSPSPPLHSHPPAVALFNEIVNRRTDPVATLGHDLLPRPPSVAAATMAVGKA
ETTLIELISTVPSAKQQRVQEAARGSMPGIADGLSRFEKEVQPLLRQARPGDHRHLFSLARRYLNSVRNNVVDAG
VTGHSIRLSKLGNSIGDWRLDTRNELVLNLCHIMLTSNPSTQANQDLAKELVDMWKHISQCRRPSQTRHPELQFT
LPSAEYIISDADNKSGIKAFNIALASIFNQHTIDEARSLVPGLLVTLAVWSDPRLTSMPLQAETATLLNMVAAAL
PHDVGRKDYLDVLLEQPKRFPPSRRRELHEYTEAHWPAAVQMLCIPHSTWRTALSKQANSRRQSSDLAVFHKQLR
AAYKSGSKGAVMSIWNEVKVRIAAQPDLLDQLAGLPDFVDYWIFVWCAMRMRFMLQETLDMMAQAKMQPTIRSYT
AMMHGWKACKDFKRILALWTQLVDSGIRLDVAIWTERISCLVAMGCAQEALQALGEMQAQWKKAVESNDASHAAV
KPSIEVVNAAFMGLLRIDYQAAHKVLAWAVLEGIEPNVRTYNALLREAFGGHDATEAVRNIFGAMQQRGVSPDGA
TFTICLEEILGTMHNRPAAEQVEAVRQVLDDMHKVGLRANGETYGKMLYAVASLPGGGADEAVAAVQKHMHESGI
EATPHMVTILLERAMARNPPGDFEGLLQRHGLNNVAKGDQTLWERVMSARANSSRPEAAMALFNELAYAGRPVTS
LPCLADLLVVLLQTKRVEDAQRVVDVVVSHKLEKQADDAWGVPRYWRHHFWHLARRNGLLPWHKLSRELQDYFGG
LEDM*
Coding >OphauG2|238
ATGGCAGCGCGCTGTCCCGCAGCATGTGTGCGCCTCTCTTCAACCTCGTCTGATGCCGCGCCGCTGGTCGACAGC
CCATCTCCCCCCCTGCACTCGCACCCTCCGGCCGTTGCCTTGTTCAATGAAATCGTCAATCGGCGGACGGACCCT
GTGGCGACGCTGGGGCATGACTTGCTGCCCAGACCGCCTTCAGTGGCCGCGGCAACAATGGCCGTGGGCAAGGCA
GAGACCACCCTGATTGAATTGATTTCCACTGTCCCGAGCGCCAAGCAGCAACGCGTGCAAGAGGCAGCCCGTGGA
AGCATGCCCGGAATCGCAGACGGGCTCTCGAGGTTTGAAAAAGAAGTGCAGCCCCTATTGCGCCAAGCCCGGCCT
GGCGACCATAGACACCTCTTTTCGCTCGCCAGACGATATCTCAACTCGGTGCGCAACAATGTTGTCGATGCCGGC
GTCACCGGCCACAGCATCCGGCTGTCCAAGCTGGGCAACAGCATTGGCGACTGGAGGCTCGACACGCGCAACGAG
CTCGTCCTCAACCTTTGCCACATCATGCTCACGTCCAACCCCTCGACCCAAGCCAACCAAGACTTGGCCAAGGAA
CTGGTTGATATGTGGAAGCATATTTCCCAGTGCCGCCGTCCAAGCCAGACCCGCCACCCCGAGCTGCAATTCACC
CTGCCCTCGGCCGAGTACATCATTTCCGACGCGGACAACAAAAGCGGCATAAAAGCCTTCAACATTGCTCTCGCC
AGCATCTTCAACCAGCACACCATTGACGAGGCGCGCAGTCTAGTGCCTGGGCTGCTGGTGACTCTTGCCGTGTGG
TCGGATCCACGCCTTACATCCATGCCACTGCAGGCCGAGACGGCCACCCTCTTGAACATGGTGGCGGCGGCCCTG
CCCCACGACGTTGGCCGAAAAGACTATCTCGACGTTCTGCTCGAGCAGCCAAAACGATTTCCCCCCTCGAGACGA
CGCGAGCTGCACGAGTACACAGAGGCGCACTGGCCAGCGGCGGTGCAAATGCTGTGCATCCCGCACTCGACGTGG
CGCACCGCTCTATCCAAGCAAGCAAATTCGCGGCGCCAGAGCTCCGACTTGGCCGTCTTCCACAAGCAGCTTCGA
GCCGCTTACAAAAGTGGGAGCAAGGGAGCCGTCATGTCCATTTGGAACGAGGTCAAGGTGCGCATAGCGGCTCAG
CCAGACCTCCTTGACCAGCTGGCTGGCTTGCCCGACTTTGTCGACTACTGGATATTTGTCTGGTGCGCCATGCGA
ATGCGCTTCATGCTGCAAGAGACGCTTGACATGATGGCACAGGCCAAGATGCAGCCCACCATTCGCTCCTACACG
GCCATGATGCACGGCTGGAAGGCGTGCAAGGACTTTAAGCGCATCCTGGCGCTGTGGACTCAGCTTGTTGACTCG
GGCATCCGCCTCGACGTGGCCATTTGGACGGAGCGCATCTCGTGCTTGGTTGCCATGGGCTGTGCGCAAGAGGCT
TTGCAAGCGCTGGGAGAGATGCAGGCGCAATGGAAAAAGGCAGTAGAGTCCAACGACGCCTCGCACGCCGCTGTC
AAGCCCAGTATCGAGGTGGTGAATGCAGCCTTTATGGGCCTGCTGCGCATCGACTACCAAGCGGCGCACAAGGTG
CTGGCGTGGGCGGTGCTCGAGGGCATAGAGCCCAACGTGCGCACCTACAACGCACTGCTGCGCGAGGCCTTTGGC
GGCCACGATGCGACGGAAGCCGTGCGCAACATTTTTGGCGCCATGCAGCAGCGGGGGGTCAGTCCCGATGGCGCC
ACCTTTACCATTTGCCTCGAGGAGATTCTGGGCACCATGCACAACCGGCCAGCGGCTGAGCAGGTCGAGGCGGTG
CGGCAGGTGCTCGACGACATGCACAAGGTAGGCCTGCGGGCCAATGGAGAGACATACGGCAAGATGCTTTATGCC
GTGGCGTCGCTGCCCGGCGGCGGGGCAGACGAGGCGGTTGCCGCGGTGCAGAAGCACATGCACGAGTCTGGCATC
GAGGCTACGCCGCACATGGTGACCATTTTGCTGGAGCGAGCCATGGCGCGCAACCCCCCCGGGGATTTCGAGGGC
CTGCTGCAGCGCCACGGGCTCAACAATGTGGCCAAGGGCGACCAGACGCTGTGGGAGCGCGTCATGAGTGCGCGG
GCAAACTCGAGCCGTCCCGAGGCGGCCATGGCGCTGTTTAATGAGCTGGCGTATGCAGGGCGGCCCGTCACGTCG
CTGCCTTGTCTGGCCGACCTGCTGGTGGTGCTGCTGCAGACCAAGCGCGTAGAGGATGCACAGCGCGTGGTTGAC
GTGGTGGTGTCGCACAAGCTGGAAAAGCAGGCCGATGATGCCTGGGGCGTGCCGCGGTATTGGCGCCATCACTTT
TGGCACCTGGCGCGTAGAAATGGCTTGTTGCCGTGGCACAAGCTGTCGCGCGAGCTACAGGATTACTTTGGCGGC
CTCGAGGACATGTAG
Transcript >OphauG2|238
ATGGCAGCGCGCTGTCCCGCAGCATGTGTGCGCCTCTCTTCAACCTCGTCTGATGCCGCGCCGCTGGTCGACAGC
CCATCTCCCCCCCTGCACTCGCACCCTCCGGCCGTTGCCTTGTTCAATGAAATCGTCAATCGGCGGACGGACCCT
GTGGCGACGCTGGGGCATGACTTGCTGCCCAGACCGCCTTCAGTGGCCGCGGCAACAATGGCCGTGGGCAAGGCA
GAGACCACCCTGATTGAATTGATTTCCACTGTCCCGAGCGCCAAGCAGCAACGCGTGCAAGAGGCAGCCCGTGGA
AGCATGCCCGGAATCGCAGACGGGCTCTCGAGGTTTGAAAAAGAAGTGCAGCCCCTATTGCGCCAAGCCCGGCCT
GGCGACCATAGACACCTCTTTTCGCTCGCCAGACGATATCTCAACTCGGTGCGCAACAATGTTGTCGATGCCGGC
GTCACCGGCCACAGCATCCGGCTGTCCAAGCTGGGCAACAGCATTGGCGACTGGAGGCTCGACACGCGCAACGAG
CTCGTCCTCAACCTTTGCCACATCATGCTCACGTCCAACCCCTCGACCCAAGCCAACCAAGACTTGGCCAAGGAA
CTGGTTGATATGTGGAAGCATATTTCCCAGTGCCGCCGTCCAAGCCAGACCCGCCACCCCGAGCTGCAATTCACC
CTGCCCTCGGCCGAGTACATCATTTCCGACGCGGACAACAAAAGCGGCATAAAAGCCTTCAACATTGCTCTCGCC
AGCATCTTCAACCAGCACACCATTGACGAGGCGCGCAGTCTAGTGCCTGGGCTGCTGGTGACTCTTGCCGTGTGG
TCGGATCCACGCCTTACATCCATGCCACTGCAGGCCGAGACGGCCACCCTCTTGAACATGGTGGCGGCGGCCCTG
CCCCACGACGTTGGCCGAAAAGACTATCTCGACGTTCTGCTCGAGCAGCCAAAACGATTTCCCCCCTCGAGACGA
CGCGAGCTGCACGAGTACACAGAGGCGCACTGGCCAGCGGCGGTGCAAATGCTGTGCATCCCGCACTCGACGTGG
CGCACCGCTCTATCCAAGCAAGCAAATTCGCGGCGCCAGAGCTCCGACTTGGCCGTCTTCCACAAGCAGCTTCGA
GCCGCTTACAAAAGTGGGAGCAAGGGAGCCGTCATGTCCATTTGGAACGAGGTCAAGGTGCGCATAGCGGCTCAG
CCAGACCTCCTTGACCAGCTGGCTGGCTTGCCCGACTTTGTCGACTACTGGATATTTGTCTGGTGCGCCATGCGA
ATGCGCTTCATGCTGCAAGAGACGCTTGACATGATGGCACAGGCCAAGATGCAGCCCACCATTCGCTCCTACACG
GCCATGATGCACGGCTGGAAGGCGTGCAAGGACTTTAAGCGCATCCTGGCGCTGTGGACTCAGCTTGTTGACTCG
GGCATCCGCCTCGACGTGGCCATTTGGACGGAGCGCATCTCGTGCTTGGTTGCCATGGGCTGTGCGCAAGAGGCT
TTGCAAGCGCTGGGAGAGATGCAGGCGCAATGGAAAAAGGCAGTAGAGTCCAACGACGCCTCGCACGCCGCTGTC
AAGCCCAGTATCGAGGTGGTGAATGCAGCCTTTATGGGCCTGCTGCGCATCGACTACCAAGCGGCGCACAAGGTG
CTGGCGTGGGCGGTGCTCGAGGGCATAGAGCCCAACGTGCGCACCTACAACGCACTGCTGCGCGAGGCCTTTGGC
GGCCACGATGCGACGGAAGCCGTGCGCAACATTTTTGGCGCCATGCAGCAGCGGGGGGTCAGTCCCGATGGCGCC
ACCTTTACCATTTGCCTCGAGGAGATTCTGGGCACCATGCACAACCGGCCAGCGGCTGAGCAGGTCGAGGCGGTG
CGGCAGGTGCTCGACGACATGCACAAGGTAGGCCTGCGGGCCAATGGAGAGACATACGGCAAGATGCTTTATGCC
GTGGCGTCGCTGCCCGGCGGCGGGGCAGACGAGGCGGTTGCCGCGGTGCAGAAGCACATGCACGAGTCTGGCATC
GAGGCTACGCCGCACATGGTGACCATTTTGCTGGAGCGAGCCATGGCGCGCAACCCCCCCGGGGATTTCGAGGGC
CTGCTGCAGCGCCACGGGCTCAACAATGTGGCCAAGGGCGACCAGACGCTGTGGGAGCGCGTCATGAGTGCGCGG
GCAAACTCGAGCCGTCCCGAGGCGGCCATGGCGCTGTTTAATGAGCTGGCGTATGCAGGGCGGCCCGTCACGTCG
CTGCCTTGTCTGGCCGACCTGCTGGTGGTGCTGCTGCAGACCAAGCGCGTAGAGGATGCACAGCGCGTGGTTGAC
GTGGTGGTGTCGCACAAGCTGGAAAAGCAGGCCGATGATGCCTGGGGCGTGCCGCGGTATTGGCGCCATCACTTT
TGGCACCTGGCGCGTAGAAATGGCTTGTTGCCGTGGCACAAGCTGTCGCGCGAGCTACAGGATTACTTTGGCGGC
CTCGAGGACATGTAG
Gene >OphauG2|238
ATGGCAGCGCGCTGTCCCGCAGCATGTGTGCGCCTCTCTTCAACCTCGTCTGATGCCGCGCCGCTGGTCGACAGC
CCATCTCCCCCCCTGCACTCGCACCCTCCGGCCGTTGCCTTGTTCAATGAAATCGTCAATCGGCGGACGGACCCT
GTGGCGACGCTGGGGCATGACTTGCTGCCCAGACCGCCTTCAGTGGCCGCGGCAACAATGGCCGTGGGCAAGGCA
GAGACCACCCTGATTGAATTGATTTCCACTGTCCCGAGCGCCAAGCAGCAACGCGTGCAAGAGGCAGCCCGTGGA
AGCATGCCCGGAATCGCAGACGGGCTCTCGAGGTTTGAAAAAGAAGTGCAGCCCCTATTGCGCCAAGCCCGGCCT
GGCGACCATAGACACCTCTTTTCGCTCGCCAGACGATATCTCAACTCGGTGCGCAACAATGTTGTCGATGCCGGC
GTCACCGGCCACAGCATCCGGCTGTCCAAGCTGGGCAACAGCATTGGCGACTGGAGGCTCGACACGCGCAACGAG
CTCGTCCTCAACCTTTGCCACATCATGCTCACGTCCAACCCCTCGACCCAAGCCAACCAAGACTTGGCCAAGGAA
CTGGTTGATATGTGGAAGCATATTTCCCAGTGCCGCCGTCCAAGCCAGACCCGCCACCCCGAGCTGCAATTCACC
CTGCCCTCGGCCGAGTACATCATTTCCGACGCGGACAACAAAAGCGGCATAAAAGCCTTCAACATTGCTCTCGCC
AGCATCTTCAACCAGCACACCATTGACGAGGCGCGCAGTCTAGTGCCTGGGCTGCTGGTGACTCTTGCCGTGTGG
TCGGATCCACGCCTTACATCCATGCCACTGCAGGCCGAGACGGCCACCCTCTTGAACATGGTGGCGGCGGCCCTG
CCCCACGACGTTGGCCGAAAAGACTATCTCGACGTTCTGCTCGAGCAGCCAAAACGATTTCCCCCCTCGAGACGA
CGCGAGCTGCACGAGTACACAGAGGCGCACTGGCCAGCGGCGGTGCAAATGCTGTGCATCCCGCACTCGACGTGG
CGCACCGCTCTATCCAAGCAAGCAAATTCGCGGCGCCAGAGCTCCGACTTGGCCGTCTTCCACAAGCAGCTTCGA
GCCGCTTACAAAAGTGGGAGCAAGGGAGCCGTCATGTCCATTTGGAACGAGGTCAAGGTGCGCATAGCGGCTCAG
CCAGACCTCCTTGACCAGCTGGCTGGCTTGCCCGACTTTGTCGACTACTGGATATTTGTCTGGTGCGCCATGCGA
ATGCGCTTCATGCTGCAAGAGACGCTTGACATGATGGCACAGGCCAAGATGCAGCCCACCATTCGCTCCTACACG
GCCATGATGCACGGCTGGAAGGCGTGCAAGGACTTTAAGCGCATCCTGGCGCTGTGGACTCAGCTTGTTGACTCG
GGCATCCGCCTCGACGTGGCCATTTGGACGGAGCGCATCTCGTGCTTGGTTGCCATGGGCTGTGCGCAAGAGGCT
TTGCAAGCGCTGGGAGAGATGCAGGCGCAATGGAAAAAGGCAGTAGAGTCCAACGACGCCTCGCACGCCGCTGTC
AAGCCCAGTATCGAGGTGGTGAATGCAGCCTTTATGGGCCTGCTGCGCATCGACTACCAAGCGGCGCACAAGGTG
CTGGCGTGGGCGGTGCTCGAGGGCATAGAGCCCAACGTGCGCACCTACAACGCACTGCTGCGCGAGGCCTTTGGC
GGCCACGATGCGACGGAAGCCGTGCGCAACATTTTTGGCGCCATGCAGCAGCGGGGGGTCAGTCCCGATGGCGCC
ACCTTTACCATTTGCCTCGAGGAGATTCTGGGCACCATGCACAACCGGCCAGCGGCTGAGCAGGTCGAGGCGGTG
CGGCAGGTGCTCGACGACATGCACAAGGTAGGCCTGCGGGCCAATGGAGAGACATACGGCAAGATGCTTTATGCC
GTGGCGTCGCTGCCCGGCGGCGGGGCAGACGAGGCGGTTGCCGCGGTGCAGAAGCACATGCACGAGTCTGGCATC
GAGGCTACGCCGCACATGGTGACCATTTTGCTGGAGCGAGCCATGGCGCGCAACCCCCCCGGGGATTTCGAGGGC
CTGCTGCAGCGCCACGGGCTCAACAATGTGGCCAAGGGCGACCAGACGCTGTGGGAGCGCGTCATGAGTGCGCGG
GCAAACTCGAGCCGTCCCGAGGCGGCCATGGCGCTGTTTAATGAGCTGGCGTATGCAGGGCGGCCCGTCACGTCG
CTGCCTTGTCTGGCCGACCTGCTGGTGGTGCTGCTGCAGACCAAGCGCGTAGAGGATGCACAGCGCGTGGTTGAC
GTGGTGGTGTCGCACAAGCTGGAAAAGCAGGCCGATGATGCCTGGGGCGTGCCGCGGTATTGGCGCCATCACTTT
TGGCACCTGGCGCGTAGAAATGGCTTGTTGCCGTGGCACAAGCTGTCGCGCGAGCTACAGGATTACTTTGGCGGC
CTCGAGGACATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail