Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2378
Gene name
LocationContig_185:9487..10163
Strand-
Gene length (bp)676
Transcript length (bp)591
Coding sequence length (bp)591
Protein length (aa) 197

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09056 Phospholip_A2_3 Prokaryotic phospholipase A2 4.6E-43 37 144

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B0M5|A2001_ARTBC Uncharacterized secreted protein ARB_02001 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02001 PE=1 SV=1 35 144 2.0E-30

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2378
MHYLFLVLLSTALAAPTTNTTSEAGLTEVQEHDLALTDDILFTESLPDFLARREKMDPDTYDWSSDGCSYSPDNP
FGFPFEPACQRHDFGYRNYKIENRFTSENRKKIDDNFSKDLQNQCSTSSVPRVCRSLANVYYWAVRAFGGLASRK
RDEGTNELMVIDSAAKDEYDKALAEYEQAVKEAQEQGALPVLDNVA*
Coding >OphauG2|2378
ATGCATTATCTATTTCTTGTCCTTCTTTCAACGGCCCTTGCGGCTCCGACCACGAACACGACCTCTGAAGCTGGC
TTAACAGAGGTCCAAGAACATGACCTAGCTCTTACGGACGACATCCTCTTTACCGAGTCTCTCCCCGACTTTTTG
GCGCGTCGGGAGAAAATGGACCCTGATACTTATGACTGGTCATCTGATGGATGCAGCTATTCTCCAGACAATCCT
TTTGGCTTTCCTTTTGAGCCGGCATGCCAGCGCCACGACTTTGGTTATCGCAACTACAAAATCGAAAACCGGTTT
ACTTCAGAAAACCGCAAGAAAATTGACGACAATTTCAGCAAAGATCTGCAGAATCAATGCTCCACGTCTTCGGTT
CCACGAGTCTGCAGGTCACTCGCCAACGTATACTACTGGGCCGTTCGAGCATTTGGAGGCCTCGCGTCAAGGAAA
CGTGATGAAGGCACCAATGAACTCATGGTCATTGATTCCGCTGCAAAGGACGAATACGACAAGGCCCTCGCCGAA
TACGAACAGGCCGTCAAAGAGGCTCAAGAGCAGGGTGCCCTTCCAGTGTTGGATAATGTTGCATAG
Transcript >OphauG2|2378
ATGCATTATCTATTTCTTGTCCTTCTTTCAACGGCCCTTGCGGCTCCGACCACGAACACGACCTCTGAAGCTGGC
TTAACAGAGGTCCAAGAACATGACCTAGCTCTTACGGACGACATCCTCTTTACCGAGTCTCTCCCCGACTTTTTG
GCGCGTCGGGAGAAAATGGACCCTGATACTTATGACTGGTCATCTGATGGATGCAGCTATTCTCCAGACAATCCT
TTTGGCTTTCCTTTTGAGCCGGCATGCCAGCGCCACGACTTTGGTTATCGCAACTACAAAATCGAAAACCGGTTT
ACTTCAGAAAACCGCAAGAAAATTGACGACAATTTCAGCAAAGATCTGCAGAATCAATGCTCCACGTCTTCGGTT
CCACGAGTCTGCAGGTCACTCGCCAACGTATACTACTGGGCCGTTCGAGCATTTGGAGGCCTCGCGTCAAGGAAA
CGTGATGAAGGCACCAATGAACTCATGGTCATTGATTCCGCTGCAAAGGACGAATACGACAAGGCCCTCGCCGAA
TACGAACAGGCCGTCAAAGAGGCTCAAGAGCAGGGTGCCCTTCCAGTGTTGGATAATGTTGCATAG
Gene >OphauG2|2378
ATGCATTATCTATTTCTTGTCCTTCTTTCAACGGCCCTTGCGGCTCCGACCACGAACACGACCTCTGAAGCTGGC
TTAACAGAGGTCCAAGAACATGACCTAGCTCTTACGGACGACATCCTCTTTACCGAGTCTCTCCCCGACTTTTTG
GCGCGTCGGGAGAAAATGGACCCTGATACTTATGACTGGTCATCTGATGGATGCAGCTATTCTCCAGACAATCCT
TTTGGCTTTCCTTTTGAGCCGGCATGCCAGCGCCACGACTTTGGTTATCGCAACTACAAAATCGAAAACCGGTTT
ACTTCAGAAAACCGCAAGAAAATTGACGACAATTTCAGCAAAGAGTAAGTAGACCCTTTTTATTTCACTGCCGCA
TTTGTCCACTTGGCCGTGGCACATCTGGCAAAACGGAGAGACTGACTTGAGTAGTCTGCAGAATCAATGCTCCAC
GTCTTCGGTTCCACGAGTCTGCAGGTCACTCGCCAACGTATACTACTGGGCCGTTCGAGCATTTGGAGGCCTCGC
GTCAAGGAAACGTGATGAAGGCACCAATGAACTCATGGTCATTGATTCCGCTGCAAAGGACGAATACGACAAGGC
CCTCGCCGAATACGAACAGGCCGTCAAAGAGGCTCAAGAGCAGGGTGCCCTTCCAGTGTTGGATAATGTTGCATA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail