Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|237
Gene name
LocationContig_1048:101..912
Strand+
Gene length (bp)811
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 1.7E-04 125 204

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40582|GST1_YEAST Glutathione S-transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTT1 PE=1 SV=1 3 223 6.0E-25

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|237
MLAPPELEKIHPLGKSPVVTVTPAGQPGAKEIVLAESGLMTQYLCEHLPEGKRLMPTRWREGMEGKIGGETDGWM
RYQYLLHYAEGSLMPVMVISLIMSRLKSSDVPFFIRPITGAAANRVIALFVLPNAVKHMRLIDDMLATSGGRYLC
GDKLTAADILMSFPLLAGRDRWDEMGKWGGGATNAGGTWAEAFPRIVEYTARLEKEEGYRRSIERIEAVDGKFEA
SL*
Coding >OphauG2|237
ATGCTGGCGCCGCCCGAGTTGGAGAAGATACACCCGCTGGGCAAGTCGCCCGTGGTTACAGTGACACCAGCGGGA
CAGCCGGGGGCCAAGGAGATTGTGCTGGCCGAGAGCGGGCTCATGACGCAGTACCTGTGTGAGCATTTACCAGAG
GGAAAGAGATTGATGCCGACCAGGTGGCGCGAGGGCATGGAGGGCAAGATTGGGGGGGAGACGGATGGGTGGATG
CGATACCAGTACTTGCTTCACTATGCCGAGGGGAGCTTGATGCCAGTAATGGTTATTTCGCTCATTATGTCTCGC
CTCAAGTCAAGCGACGTGCCCTTCTTCATTCGGCCCATTACAGGGGCGGCGGCAAATCGCGTCATAGCGCTCTTT
GTGCTGCCCAACGCCGTCAAGCACATGCGTCTGATTGACGACATGCTGGCCACATCGGGGGGCCGCTACCTCTGC
GGCGACAAGCTGACGGCGGCCGACATTCTCATGAGCTTCCCTCTGCTGGCTGGGCGGGATCGCTGGGATGAAATG
GGCAAATGGGGAGGAGGAGCGACCAATGCGGGGGGGACGTGGGCAGAGGCGTTTCCACGGATAGTCGAGTACACG
GCGCGGCTGGAGAAGGAGGAGGGATATCGGCGCAGCATTGAGCGCATCGAGGCGGTTGATGGCAAGTTTGAGGCT
TCGCTGTAG
Transcript >OphauG2|237
ATGCTGGCGCCGCCCGAGTTGGAGAAGATACACCCGCTGGGCAAGTCGCCCGTGGTTACAGTGACACCAGCGGGA
CAGCCGGGGGCCAAGGAGATTGTGCTGGCCGAGAGCGGGCTCATGACGCAGTACCTGTGTGAGCATTTACCAGAG
GGAAAGAGATTGATGCCGACCAGGTGGCGCGAGGGCATGGAGGGCAAGATTGGGGGGGAGACGGATGGGTGGATG
CGATACCAGTACTTGCTTCACTATGCCGAGGGGAGCTTGATGCCAGTAATGGTTATTTCGCTCATTATGTCTCGC
CTCAAGTCAAGCGACGTGCCCTTCTTCATTCGGCCCATTACAGGGGCGGCGGCAAATCGCGTCATAGCGCTCTTT
GTGCTGCCCAACGCCGTCAAGCACATGCGTCTGATTGACGACATGCTGGCCACATCGGGGGGCCGCTACCTCTGC
GGCGACAAGCTGACGGCGGCCGACATTCTCATGAGCTTCCCTCTGCTGGCTGGGCGGGATCGCTGGGATGAAATG
GGCAAATGGGGAGGAGGAGCGACCAATGCGGGGGGGACGTGGGCAGAGGCGTTTCCACGGATAGTCGAGTACACG
GCGCGGCTGGAGAAGGAGGAGGGATATCGGCGCAGCATTGAGCGCATCGAGGCGGTTGATGGCAAGTTTGAGGCT
TCGCTGTAG
Gene >OphauG2|237
ATGCTGGCGCCGCCCGAGTTGGAGAAGATACACCCGCTGGGCAAGTCGCCCGTGGTTACAGTGACACCAGCGGGA
CAGCCGGGGGCCAAGGAGATTGTGCTGGCCGAGAGCGGGCTCATGACGCAGTACCTGTGTGAGCATTTACCAGAG
GGAAAGAGATTGATGCCGACCAGGTGGCGCGAGGGCATGGAGGGCAAGATTGGGGGGGAGACGGATGGGTGGATG
CGATACCAGTACTTGCTTCACTATGCCGAGGGGAGCTTGATGCCAGTAATGGTTATTTCGCTCATTATGTCTCGT
GAGTCTTGATTTGCTCTGGCCTGGTCTTCTCGCCTAGTCTGCTCTGCGGGCAGGACAGGACAGGACAGGACAGGA
CATGATGGCATGTTTCAAGCAAGGCTAATGCGGTAAGCAACAAGCAACAGGCCTCAAGTCAAGCGACGTGCCCTT
CTTCATTCGGCCCATTACAGGGGCGGCGGCAAATCGCGTCATAGCGCTCTTTGTGCTGCCCAACGCCGTCAAGCA
CATGCGTCTGATTGACGACATGCTGGCCACATCGGGGGGCCGCTACCTCTGCGGCGACAAGCTGACGGCGGCCGA
CATTCTCATGAGCTTCCCTCTGCTGGCTGGGCGGGATCGCTGGGATGAAATGGGCAAATGGGGAGGAGGAGCGAC
CAATGCGGGGGGGACGTGGGCAGAGGCGTTTCCACGGATAGTCGAGTACACGGCGCGGCTGGAGAAGGAGGAGGG
ATATCGGCGCAGCATTGAGCGCATCGAGGCGGTTGATGGCAAGTTTGAGGCTTCGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail