Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2364
Gene name
LocationContig_184:23099..25439
Strand+
Gene length (bp)2340
Transcript length (bp)2256
Coding sequence length (bp)2256
Protein length (aa) 752

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12331 DUF3636 Protein of unknown function (DUF3636) 1.4E-33 478 624

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2364
MTLDDFSDDDFADLTDNALQELERNAIQLTQAKSPQQSSYPDYGWQDEDDDLDTTEVTNIIGLPIARPVVDNALL
QQHAKLLPHLSSAAPEADSRWNAAAAGLAVRPRQSLAAAPSQSLAASQRFQAPPQPSRFTRPSQSQGHDIVEALQ
RRVRSLEAQLNASRGENSIIRANLTKTRSDHEAHIARLQAEKANQVAEKQRIADAAMEAEKNANTELQFMQRDLR
EVSDRARRKDAPALATPRKTNKSWSLADGFDHMDIVVSPSKGLGRSRGSGPVAVHVGERTPSKGKRKRPPIDSPV
AELDIDIQGGFVSQEKPAAAADVDQTNMAVSHVAPLDFLQLILDHGASYQQPPTFDTLSRYTLPADATQTSFASM
IFEKLPLMGHPGRPMQLLVDFAEHIISLWTSCVQQDLWEPIKHLVALVSFTLDLHASSVAPHLVSSLVPVAQQTI
RDVAQRRHRCPDGGLAKDNVPQQHIETKSIFGLLLTVAMACATTPSETPDGFRYTAVEFWRLVCHDTVLLLLSPK
QNLDDTIATLDLLALSPLPDSIGPVSQEIEPITIARDVIERVSSKLVDSMRSPMTAKQRRVLHLATLRTLIAFAR
YPFGALQLASHDNALPRLVMCLCRCVDDLYDQSVCTSTSSSSWLGVSRPLASAEPTASAQLHGIIAQSLLLIHSL
VTDPNTSNAAEISHKLSMTHGGSQRYILALGRLTFADEDHVIEAAISGDVVDAAHELLELAVTPDEGETVSEAFG
A*
Coding >OphauG2|2364
ATGACGCTCGACGACTTTTCCGACGACGACTTTGCCGACCTGACGGATAATGCTCTCCAGGAGCTCGAGCGCAAC
GCCATCCAGCTGACACAGGCCAAGTCGCCGCAGCAGAGCAGCTACCCCGACTACGGCTGGCAAGACGAAGATGAC
GACCTCGATACCACCGAAGTCACCAACATCATTGGCCTTCCCATTGCTCGCCCAGTCGTCGACAATGCCTTGCTC
CAGCAGCACGCAAAGCTGCTGCCTCATCTTTCATCTGCTGCTCCCGAGGCCGACTCGAGATGGAACGCTGCCGCT
GCTGGCTTGGCCGTGCGTCCCCGTCAGTCTCTTGCTGCCGCTCCAAGCCAGTCGCTTGCTGCCTCTCAGCGCTTC
CAGGCCCCGCCACAACCGAGCCGCTTTACACGCCCCTCGCAGTCCCAAGGCCACGACATTGTCGAGGCCTTGCAG
CGACGCGTACGGTCGTTGGAGGCCCAACTTAATGCGTCTCGCGGCGAAAACTCCATCATCCGCGCCAACTTGACC
AAGACTCGTAGCGACCATGAGGCCCATATTGCACGCCTCCAGGCCGAAAAGGCCAACCAAGTGGCGGAGAAGCAA
CGCATCGCCGACGCCGCCATGGAGGCGGAGAAAAATGCCAACACGGAGCTCCAGTTTATGCAACGCGACCTGCGC
GAGGTTAGTGACCGAGCGCGAAGAAAGGACGCTCCAGCCTTGGCGACGCCTCGCAAGACCAACAAGTCGTGGAGT
CTGGCCGATGGTTTTGACCACATGGACATTGTCGTCAGCCCGTCAAAGGGCCTTGGCCGGTCGCGAGGCTCTGGG
CCAGTGGCAGTCCATGTCGGCGAGAGGACTCCATCCAAGGGCAAGCGAAAGCGCCCGCCCATTGACAGCCCTGTG
GCAGAGCTGGACATTGATATCCAAGGCGGTTTCGTGAGCCAAGAGAAGCCTGCTGCTGCTGCTGATGTTGATCAA
ACCAACATGGCCGTTTCCCATGTTGCACCGTTGGATTTTTTACAGCTCATCCTCGACCACGGGGCCTCTTATCAG
CAGCCACCAACATTTGACACCTTGTCTCGTTACACATTGCCAGCAGATGCGACGCAAACGTCGTTTGCCTCTATG
ATTTTTGAAAAGCTGCCCTTGATGGGCCATCCCGGCCGACCAATGCAGCTTCTCGTAGATTTTGCCGAGCACATC
ATCTCGCTCTGGACCAGCTGTGTCCAACAAGACCTTTGGGAGCCAATAAAGCACCTCGTCGCTCTCGTCTCCTTT
ACCCTTGATCTCCATGCCTCTTCAGTCGCGCCCCACCTGGTTTCAAGCCTCGTGCCAGTTGCACAGCAGACTATT
CGCGACGTCGCCCAGAGACGCCATCGATGTCCAGACGGAGGCCTTGCCAAAGACAATGTCCCCCAACAGCACATT
GAAACAAAATCCATCTTTGGCCTGCTTCTCACAGTGGCAATGGCCTGTGCCACAACGCCCAGCGAGACGCCAGAC
GGCTTTCGCTACACAGCCGTCGAGTTTTGGAGGCTTGTATGCCACGACACTGTGCTTTTACTACTTTCGCCAAAG
CAAAACCTCGACGACACAATTGCAACGTTGGACTTGTTGGCCTTGTCTCCACTGCCCGATTCAATTGGCCCTGTC
AGCCAAGAAATCGAGCCAATCACCATTGCGCGAGATGTCATTGAGCGAGTGTCGTCCAAGCTGGTCGACTCGATG
CGCTCGCCAATGACGGCCAAGCAGAGAAGAGTACTGCATCTGGCCACTCTACGAACCCTCATTGCATTTGCCCGG
TATCCGTTTGGCGCCTTGCAGCTTGCATCTCACGATAACGCCCTCCCGCGTCTGGTCATGTGTCTTTGCAGATGC
GTCGACGACCTGTACGACCAATCCGTTTGCACCAGCACTAGCAGCTCTAGCTGGTTGGGAGTTTCTCGTCCACTA
GCCTCAGCTGAGCCAACGGCTAGCGCCCAACTCCATGGCATCATTGCTCAAAGCCTTCTTTTGATTCATAGTCTA
GTAACAGATCCGAACACGTCTAATGCAGCCGAAATTAGCCACAAGCTGTCCATGACCCATGGCGGCAGCCAGCGA
TACATCCTGGCCCTGGGTCGGCTCACATTTGCCGATGAGGATCATGTTATCGAGGCTGCCATTAGTGGTGATGTG
GTGGATGCGGCACATGAGTTGCTTGAACTCGCCGTGACGCCTGACGAAGGCGAAACTGTCAGTGAGGCTTTTGGG
GCATAG
Transcript >OphauG2|2364
ATGACGCTCGACGACTTTTCCGACGACGACTTTGCCGACCTGACGGATAATGCTCTCCAGGAGCTCGAGCGCAAC
GCCATCCAGCTGACACAGGCCAAGTCGCCGCAGCAGAGCAGCTACCCCGACTACGGCTGGCAAGACGAAGATGAC
GACCTCGATACCACCGAAGTCACCAACATCATTGGCCTTCCCATTGCTCGCCCAGTCGTCGACAATGCCTTGCTC
CAGCAGCACGCAAAGCTGCTGCCTCATCTTTCATCTGCTGCTCCCGAGGCCGACTCGAGATGGAACGCTGCCGCT
GCTGGCTTGGCCGTGCGTCCCCGTCAGTCTCTTGCTGCCGCTCCAAGCCAGTCGCTTGCTGCCTCTCAGCGCTTC
CAGGCCCCGCCACAACCGAGCCGCTTTACACGCCCCTCGCAGTCCCAAGGCCACGACATTGTCGAGGCCTTGCAG
CGACGCGTACGGTCGTTGGAGGCCCAACTTAATGCGTCTCGCGGCGAAAACTCCATCATCCGCGCCAACTTGACC
AAGACTCGTAGCGACCATGAGGCCCATATTGCACGCCTCCAGGCCGAAAAGGCCAACCAAGTGGCGGAGAAGCAA
CGCATCGCCGACGCCGCCATGGAGGCGGAGAAAAATGCCAACACGGAGCTCCAGTTTATGCAACGCGACCTGCGC
GAGGTTAGTGACCGAGCGCGAAGAAAGGACGCTCCAGCCTTGGCGACGCCTCGCAAGACCAACAAGTCGTGGAGT
CTGGCCGATGGTTTTGACCACATGGACATTGTCGTCAGCCCGTCAAAGGGCCTTGGCCGGTCGCGAGGCTCTGGG
CCAGTGGCAGTCCATGTCGGCGAGAGGACTCCATCCAAGGGCAAGCGAAAGCGCCCGCCCATTGACAGCCCTGTG
GCAGAGCTGGACATTGATATCCAAGGCGGTTTCGTGAGCCAAGAGAAGCCTGCTGCTGCTGCTGATGTTGATCAA
ACCAACATGGCCGTTTCCCATGTTGCACCGTTGGATTTTTTACAGCTCATCCTCGACCACGGGGCCTCTTATCAG
CAGCCACCAACATTTGACACCTTGTCTCGTTACACATTGCCAGCAGATGCGACGCAAACGTCGTTTGCCTCTATG
ATTTTTGAAAAGCTGCCCTTGATGGGCCATCCCGGCCGACCAATGCAGCTTCTCGTAGATTTTGCCGAGCACATC
ATCTCGCTCTGGACCAGCTGTGTCCAACAAGACCTTTGGGAGCCAATAAAGCACCTCGTCGCTCTCGTCTCCTTT
ACCCTTGATCTCCATGCCTCTTCAGTCGCGCCCCACCTGGTTTCAAGCCTCGTGCCAGTTGCACAGCAGACTATT
CGCGACGTCGCCCAGAGACGCCATCGATGTCCAGACGGAGGCCTTGCCAAAGACAATGTCCCCCAACAGCACATT
GAAACAAAATCCATCTTTGGCCTGCTTCTCACAGTGGCAATGGCCTGTGCCACAACGCCCAGCGAGACGCCAGAC
GGCTTTCGCTACACAGCCGTCGAGTTTTGGAGGCTTGTATGCCACGACACTGTGCTTTTACTACTTTCGCCAAAG
CAAAACCTCGACGACACAATTGCAACGTTGGACTTGTTGGCCTTGTCTCCACTGCCCGATTCAATTGGCCCTGTC
AGCCAAGAAATCGAGCCAATCACCATTGCGCGAGATGTCATTGAGCGAGTGTCGTCCAAGCTGGTCGACTCGATG
CGCTCGCCAATGACGGCCAAGCAGAGAAGAGTACTGCATCTGGCCACTCTACGAACCCTCATTGCATTTGCCCGG
TATCCGTTTGGCGCCTTGCAGCTTGCATCTCACGATAACGCCCTCCCGCGTCTGGTCATGTGTCTTTGCAGATGC
GTCGACGACCTGTACGACCAATCCGTTTGCACCAGCACTAGCAGCTCTAGCTGGTTGGGAGTTTCTCGTCCACTA
GCCTCAGCTGAGCCAACGGCTAGCGCCCAACTCCATGGCATCATTGCTCAAAGCCTTCTTTTGATTCATAGTCTA
GTAACAGATCCGAACACGTCTAATGCAGCCGAAATTAGCCACAAGCTGTCCATGACCCATGGCGGCAGCCAGCGA
TACATCCTGGCCCTGGGTCGGCTCACATTTGCCGATGAGGATCATGTTATCGAGGCTGCCATTAGTGGTGATGTG
GTGGATGCGGCACATGAGTTGCTTGAACTCGCCGTGACGCCTGACGAAGGCGAAACTGTCAGTGAGGCTTTTGGG
GCATAG
Gene >OphauG2|2364
ATGACGCTCGACGACTTTTCCGACGACGACTTTGCCGACCTGACGGATAATGCTCTCCAGGAGCTCGAGCGCAAC
GCCATCCAGCTGACACAGGCCAAGTCGCCGCAGCAGAGCAGCTACCCCGACTACGGCTGGCAAGACGAAGATGAC
GACCTCGATACCACCGAAGTCACCAACATCATTGGCCTTCCCATTGCTCGCCCAGTCGTCGACAATGCCTTGCTC
CAGCAGCACGCAAAGCTGCTGCCTCATCTTTCATCTGCTGCTCCCGAGGCCGACTCGAGATGGAACGCTGCCGCT
GCTGGCTTGGCCGTGCGTCCCCGTCAGTCTCTTGCTGCCGCTCCAAGCCAGTCGCTTGCTGCCTCTCAGCGCTTC
CAGGCCCCGCCACAACCGAGCCGCTTTACACGCCCCTCGCAGTCCCAAGGCCACGACATTGTCGAGGCCTTGCAG
CGACGCGTACGGTCGTTGGAGGCCCAACTTAATGCGTCTCGCGGCGAAAACTCCATCATCCGCGCCAACTTGACC
AAGACTCGTAGCGACCATGAGGCCCATATTGCACGCCTCCAGGCCGAAAAGGCCAACCAAGTGGCGGAGAAGCAA
CGCATCGCCGACGCCGCCATGGAGGCGGAGAAAAATGCCAACACGGAGCTCCAGTTTATGCAACGCGACCTGCGC
GAGGTTAGTGACCGAGCGCGAAGAAAGGACGCTCCAGCCTTGGCGACGCCTCGCAAGACCAACAAGTCGTGGAGT
CTGGCCGATGGTTTTGACCACATGGACATTGTCGTCAGCCCGTCAAAGGGCCTTGGCCGGTCGCGAGGCTCTGGG
CCAGTGGCAGTCCATGTCGGCGAGAGGACTCCATCCAAGGGCAAGCGAAAGCGCCCGCCCATTGACAGCCCTGTG
GCAGAGCTGGACATTGATATCCAAGGCGGTTTCGTGAGCCAAGAGAAGCCTGCTGCTGCTGCTGATGTTGATCAA
ACCAACATGGCCGTTTCCCATGTTGCACCGTTGGATGTATGTTGGTCTCTCAATTCTTCCATGTCTCCCTTGACC
AAGAAATCTTTACTTGACCATCATCTTCTGACTCTTTCGTCTCAGTTTTTACAGCTCATCCTCGACCACGGGGCC
TCTTATCAGCAGCCACCAACATTTGACACCTTGTCTCGTTACACATTGCCAGCAGATGCGACGCAAACGTCGTTT
GCCTCTATGATTTTTGAAAAGCTGCCCTTGATGGGCCATCCCGGCCGACCAATGCAGCTTCTCGTAGATTTTGCC
GAGCACATCATCTCGCTCTGGACCAGCTGTGTCCAACAAGACCTTTGGGAGCCAATAAAGCACCTCGTCGCTCTC
GTCTCCTTTACCCTTGATCTCCATGCCTCTTCAGTCGCGCCCCACCTGGTTTCAAGCCTCGTGCCAGTTGCACAG
CAGACTATTCGCGACGTCGCCCAGAGACGCCATCGATGTCCAGACGGAGGCCTTGCCAAAGACAATGTCCCCCAA
CAGCACATTGAAACAAAATCCATCTTTGGCCTGCTTCTCACAGTGGCAATGGCCTGTGCCACAACGCCCAGCGAG
ACGCCAGACGGCTTTCGCTACACAGCCGTCGAGTTTTGGAGGCTTGTATGCCACGACACTGTGCTTTTACTACTT
TCGCCAAAGCAAAACCTCGACGACACAATTGCAACGTTGGACTTGTTGGCCTTGTCTCCACTGCCCGATTCAATT
GGCCCTGTCAGCCAAGAAATCGAGCCAATCACCATTGCGCGAGATGTCATTGAGCGAGTGTCGTCCAAGCTGGTC
GACTCGATGCGCTCGCCAATGACGGCCAAGCAGAGAAGAGTACTGCATCTGGCCACTCTACGAACCCTCATTGCA
TTTGCCCGGTATCCGTTTGGCGCCTTGCAGCTTGCATCTCACGATAACGCCCTCCCGCGTCTGGTCATGTGTCTT
TGCAGATGCGTCGACGACCTGTACGACCAATCCGTTTGCACCAGCACTAGCAGCTCTAGCTGGTTGGGAGTTTCT
CGTCCACTAGCCTCAGCTGAGCCAACGGCTAGCGCCCAACTCCATGGCATCATTGCTCAAAGCCTTCTTTTGATT
CATAGTCTAGTAACAGATCCGAACACGTCTAATGCAGCCGAAATTAGCCACAAGCTGTCCATGACCCATGGCGGC
AGCCAGCGATACATCCTGGCCCTGGGTCGGCTCACATTTGCCGATGAGGATCATGTTATCGAGGCTGCCATTAGT
GGTGATGTGGTGGATGCGGCACATGAGTTGCTTGAACTCGCCGTGACGCCTGACGAAGGCGAAACTGTCAGTGAG
GCTTTTGGGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail