Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2360
Gene name
LocationContig_184:7109..9083
Strand-
Gene length (bp)1974
Transcript length (bp)1842
Coding sequence length (bp)1842
Protein length (aa) 614

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00412 LIM LIM domain 1.4E-09 428 485
PF00412 LIM LIM domain 4.5E-11 491 544

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36166|PXL1_YEAST Paxillin-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXL1 PE=1 SV=3 423 534 1.0E-23
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 427 539 8.0E-13
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 427 540 2.0E-12
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 427 540 2.0E-12
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 427 539 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36166|PXL1_YEAST Paxillin-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXL1 PE=1 SV=3 423 534 1.0E-23
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 427 539 8.0E-13
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 427 540 2.0E-12
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 427 540 2.0E-12
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 427 539 2.0E-12
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 428 544 2.0E-12
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 427 540 3.0E-12
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 427 544 4.0E-12
sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 397 566 8.0E-12
sp|Q7TQJ8|WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus GN=Wtip PE=1 SV=1 396 548 9.0E-12
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 427 544 1.0E-11
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 427 544 1.0E-11
sp|Q9VY77|AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster GN=jub PE=1 SV=3 424 548 1.0E-11
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 428 544 2.0E-11
sp|P20271|HM14_CAEEL Homeobox protein ceh-14 OS=Caenorhabditis elegans GN=ceh-14 PE=1 SV=3 428 541 2.0E-11
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 428 539 2.0E-11
sp|Q96IF1|AJUBA_HUMAN LIM domain-containing protein ajuba OS=Homo sapiens GN=AJUBA PE=1 SV=1 407 548 2.0E-11
sp|Q9QXD8|LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus GN=Limd1 PE=1 SV=2 397 566 3.0E-11
sp|B5DEH0|LIMD1_RAT LIM domain-containing protein 1 OS=Rattus norvegicus GN=Limd1 PE=1 SV=1 397 566 3.0E-11
sp|Q91XC0|AJUBA_MOUSE LIM domain-containing protein ajuba OS=Mus musculus GN=Ajuba PE=1 SV=1 424 548 4.0E-11
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 427 551 4.0E-11
sp|Q9UGP4|LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens GN=LIMD1 PE=1 SV=1 397 566 4.0E-11
sp|Q5U2Z2|AJUBA_RAT LIM domain-containing protein ajuba OS=Rattus norvegicus GN=Ajuba PE=1 SV=1 424 548 4.0E-11
sp|E1BKA3|AJUBA_BOVIN LIM domain-containing protein ajuba OS=Bos taurus GN=AJUBA PE=3 SV=1 411 548 4.0E-11
sp|A6NIX2|WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens GN=WTIP PE=1 SV=3 396 548 7.0E-11
sp|Q9Z1Y4|TRIP6_MOUSE Thyroid receptor-interacting protein 6 OS=Mus musculus GN=Trip6 PE=1 SV=1 401 548 2.0E-10
sp|Q3SX26|TRIP6_BOVIN Thyroid receptor-interacting protein 6 OS=Bos taurus GN=TRIP6 PE=2 SV=1 401 548 2.0E-10
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 425 548 3.0E-10
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 425 548 4.0E-10
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 428 545 4.0E-10
sp|Q15654|TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens GN=TRIP6 PE=1 SV=3 401 548 4.0E-10
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 427 546 5.0E-10
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 428 541 6.0E-10
sp|Q93052|LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens GN=LPP PE=1 SV=1 401 548 6.0E-10
sp|Q5F464|LPP_CHICK Lipoma-preferred partner homolog OS=Gallus gallus GN=LPP PE=2 SV=1 401 548 7.0E-10
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 425 548 8.0E-10
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 403 548 9.0E-10
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 403 548 1.0E-09
sp|A8DZE6|WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio GN=wtip PE=3 SV=1 424 556 1.0E-09
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 428 538 1.0E-09
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 424 545 1.0E-09
sp|P53412|LHX3_CHICK LIM/homeobox protein Lhx3 OS=Gallus gallus GN=LHX3 PE=2 SV=1 405 579 1.0E-09
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 428 542 1.0E-09
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 428 544 2.0E-09
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 428 539 2.0E-09
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 428 539 2.0E-09
sp|B7ZUL2|LIMD1_XENTR LIM domain-containing protein 1 OS=Xenopus tropicalis GN=limd1 PE=2 SV=1 396 556 2.0E-09
sp|Q06BR1|LIMD1_XENLA LIM domain-containing protein 1 OS=Xenopus laevis GN=limd1 PE=1 SV=1 424 548 2.0E-09
sp|A9LS46|WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis GN=wtip PE=2 SV=1 424 556 2.0E-09
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 427 546 2.0E-09
sp|Q9VY77|AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster GN=jub PE=1 SV=3 427 538 3.0E-09
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 428 539 3.0E-09
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 440 538 3.0E-09
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 440 538 3.0E-09
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 424 541 3.0E-09
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 428 544 4.0E-09
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 424 544 4.0E-09
sp|Q5XI07|LPP_RAT Lipoma-preferred partner homolog OS=Rattus norvegicus GN=Lpp PE=1 SV=1 401 548 4.0E-09
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 428 539 4.0E-09
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 424 544 4.0E-09
sp|Q8BFW7|LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musculus GN=Lpp PE=1 SV=1 401 548 5.0E-09
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 428 556 6.0E-09
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 428 541 6.0E-09
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 424 545 6.0E-09
sp|Q90421|LHX3_DANRE LIM/homeobox protein Lhx3 OS=Danio rerio GN=lhx3 PE=2 SV=1 428 579 9.0E-09
sp|P36200|LHX3_XENLA LIM/homeobox protein Lhx3 OS=Xenopus laevis GN=lhx3 PE=1 SV=1 419 579 1.0E-08
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 427 528 1.0E-08
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 427 528 1.0E-08
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 428 549 2.0E-08
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 425 547 2.0E-08
sp|Q04650|LMX1A_MESAU LIM homeobox transcription factor 1-alpha OS=Mesocricetus auratus GN=LMX1A PE=2 SV=1 428 552 2.0E-08
sp|Q9JKU8|LMX1A_MOUSE LIM homeobox transcription factor 1-alpha OS=Mus musculus GN=Lmx1a PE=2 SV=1 428 552 2.0E-08
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 424 545 2.0E-08
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 424 545 2.0E-08
sp|Q04584|ZYX_CHICK Zyxin OS=Gallus gallus GN=ZYX PE=1 SV=1 447 548 2.0E-08
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 427 539 2.0E-08
sp|Q969G2|LHX4_HUMAN LIM/homeobox protein Lhx4 OS=Homo sapiens GN=LHX4 PE=1 SV=2 417 579 2.0E-08
sp|P53776|LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus GN=Lhx4 PE=1 SV=4 417 579 2.0E-08
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 424 541 2.0E-08
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 425 571 3.0E-08
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 428 549 3.0E-08
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 428 545 3.0E-08
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 440 538 3.0E-08
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 427 545 3.0E-08
sp|Q0VA45|ZYX_XENTR Zyxin OS=Xenopus tropicalis GN=zyx PE=2 SV=1 388 548 3.0E-08
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 413 523 4.0E-08
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 490 549 4.0E-08
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 424 549 5.0E-08
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 428 553 5.0E-08
sp|A5H447|ZYX_XENLA Zyxin OS=Xenopus laevis GN=zyx PE=1 SV=1 431 548 5.0E-08
sp|Q9UBR4|LHX3_HUMAN LIM/homeobox protein Lhx3 OS=Homo sapiens GN=LHX3 PE=1 SV=2 428 579 5.0E-08
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 428 549 6.0E-08
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 428 549 6.0E-08
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 428 538 6.0E-08
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 428 549 7.0E-08
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 428 549 7.0E-08
sp|O97581|LHX3_PIG LIM/homeobox protein Lhx3 (Fragment) OS=Sus scrofa GN=LHX3 PE=2 SV=1 428 579 7.0E-08
sp|P61374|ISL1_RAT Insulin gene enhancer protein ISL-1 OS=Rattus norvegicus GN=Isl1 PE=2 SV=1 428 551 8.0E-08
sp|P61372|ISL1_MOUSE Insulin gene enhancer protein ISL-1 OS=Mus musculus GN=Isl1 PE=1 SV=1 428 551 8.0E-08
sp|P61373|ISL1_MESAU Insulin gene enhancer protein ISL-1 OS=Mesocricetus auratus GN=ISL1 PE=2 SV=1 428 551 8.0E-08
sp|P61371|ISL1_HUMAN Insulin gene enhancer protein ISL-1 OS=Homo sapiens GN=ISL1 PE=1 SV=1 428 551 8.0E-08
sp|P50481|LHX3_MOUSE LIM/homeobox protein Lhx3 OS=Mus musculus GN=Lhx3 PE=1 SV=1 428 579 8.0E-08
sp|P53405|ISL1_DANRE Insulin gene enhancer protein isl-1 OS=Danio rerio GN=isl1 PE=2 SV=1 428 551 9.0E-08
sp|P50211|ISL1_CHICK Insulin gene enhancer protein ISL-1 OS=Gallus gallus GN=ISL1 PE=2 SV=1 428 551 1.0E-07
sp|Q9R1R0|LHX6_MOUSE LIM/homeobox protein Lhx6 OS=Mus musculus GN=Lhx6 PE=1 SV=2 416 538 1.0E-07
sp|Q96IF1|AJUBA_HUMAN LIM domain-containing protein ajuba OS=Homo sapiens GN=AJUBA PE=1 SV=1 427 539 2.0E-07
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 422 556 2.0E-07
sp|Q04584|ZYX_CHICK Zyxin OS=Gallus gallus GN=ZYX PE=1 SV=1 427 540 2.0E-07
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 427 540 3.0E-07
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 428 540 3.0E-07
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 428 540 3.0E-07
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 427 528 3.0E-07
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 490 545 3.0E-07
sp|Q96MT3|PRIC1_HUMAN Prickle-like protein 1 OS=Homo sapiens GN=PRICKLE1 PE=1 SV=2 396 538 3.0E-07
sp|Q9UPM6|LHX6_HUMAN LIM/homeobox protein Lhx6 OS=Homo sapiens GN=LHX6 PE=1 SV=2 416 538 3.0E-07
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 490 545 3.0E-07
sp|E1BKA3|AJUBA_BOVIN LIM domain-containing protein ajuba OS=Bos taurus GN=AJUBA PE=3 SV=1 427 539 4.0E-07
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 424 528 5.0E-07
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 428 523 5.0E-07
sp|Q71FD7|FBLI1_MOUSE Filamin-binding LIM protein 1 OS=Mus musculus GN=Fblim1 PE=1 SV=2 450 556 5.0E-07
sp|Q91XC0|AJUBA_MOUSE LIM domain-containing protein ajuba OS=Mus musculus GN=Ajuba PE=1 SV=1 427 539 6.0E-07
sp|Q5U2Z2|AJUBA_RAT LIM domain-containing protein ajuba OS=Rattus norvegicus GN=Ajuba PE=1 SV=1 427 539 6.0E-07
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 428 540 8.0E-07
sp|O70209|PDLI3_MOUSE PDZ and LIM domain protein 3 OS=Mus musculus GN=Pdlim3 PE=1 SV=1 490 548 8.0E-07
sp|Q3U5C7|PRIC1_MOUSE Prickle-like protein 1 OS=Mus musculus GN=Prickle1 PE=1 SV=1 396 538 9.0E-07
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 413 523 9.0E-07
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 428 556 1.0E-06
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 428 556 1.0E-06
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 424 545 1.0E-06
sp|Q0VA45|ZYX_XENTR Zyxin OS=Xenopus tropicalis GN=zyx PE=2 SV=1 424 546 1.0E-06
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 428 528 1.0E-06
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 432 538 1.0E-06
sp|A5H447|ZYX_XENLA Zyxin OS=Xenopus laevis GN=zyx PE=1 SV=1 424 540 1.0E-06
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 428 528 1.0E-06
sp|P29673|APTE_DROME Protein apterous OS=Drosophila melanogaster GN=ap PE=2 SV=1 427 544 1.0E-06
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 428 540 1.0E-06
sp|Q53GG5|PDLI3_HUMAN PDZ and LIM domain protein 3 OS=Homo sapiens GN=PDLIM3 PE=1 SV=1 490 548 1.0E-06
sp|Q9U3F4|ZYX_CAEEL Zyxin OS=Caenorhabditis elegans GN=zyx-1 PE=1 SV=1 428 538 1.0E-06
sp|Q8UVR3|LMX1B_XENLA LIM homeobox transcription factor 1-beta.1 OS=Xenopus laevis GN=lmx1b.1 PE=2 SV=1 451 549 1.0E-06
sp|A6NIX2|WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens GN=WTIP PE=1 SV=3 427 562 2.0E-06
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 424 545 2.0E-06
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 428 563 2.0E-06
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 428 528 2.0E-06
sp|O42565|LIMK1_XENLA LIM domain kinase 1 OS=Xenopus laevis GN=limk1 PE=2 SV=1 478 545 2.0E-06
sp|Q66HS7|PDLI3_RAT PDZ and LIM domain protein 3 OS=Rattus norvegicus GN=Pdlim3 PE=1 SV=2 490 548 2.0E-06
sp|Q6QGC0|PDLI3_PIG PDZ and LIM domain protein 3 OS=Sus scrofa GN=PDLIM3 PE=2 SV=1 490 548 2.0E-06
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 490 545 2.0E-06
sp|Q28FG2|PRIC1_XENTR Prickle-like protein 1 OS=Xenopus tropicalis GN=prickle1 PE=2 SV=1 396 538 2.0E-06
sp|P53413|LMX1B_CHICK LIM/homeobox protein LMX-1.2 OS=Gallus gallus GN=LMX1B PE=2 SV=2 417 541 2.0E-06
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 428 541 3.0E-06
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 424 545 3.0E-06
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 424 545 3.0E-06
sp|O88609|LMX1B_MOUSE LIM homeobox transcription factor 1-beta OS=Mus musculus GN=Lmx1b PE=2 SV=3 451 552 3.0E-06
sp|Q292U5|ESN_DROPS Protein espinas OS=Drosophila pseudoobscura pseudoobscura GN=esn PE=3 SV=1 399 538 3.0E-06
sp|Q80VL3|PRIC3_MOUSE Prickle-like protein 3 OS=Mus musculus GN=Prickle3 PE=1 SV=1 428 525 3.0E-06
sp|O60663|LMX1B_HUMAN LIM homeobox transcription factor 1-beta OS=Homo sapiens GN=LMX1B PE=1 SV=3 451 552 3.0E-06
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 428 548 4.0E-06
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 428 556 4.0E-06
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 428 556 4.0E-06
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 424 545 4.0E-06
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 447 540 4.0E-06
sp|Q60564|LMX1B_MESAU LIM homeobox transcription factor 1-beta (Fragment) OS=Mesocricetus auratus GN=LMX1B PE=2 SV=1 451 552 4.0E-06
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 427 538 4.0E-06
sp|Q3SYZ8|PDLI3_BOVIN PDZ and LIM domain protein 3 OS=Bos taurus GN=PDLIM3 PE=2 SV=1 490 548 5.0E-06
sp|Q19157|PIN2_CAEEL LIM domain-containing protein pin-2 OS=Caenorhabditis elegans GN=pin-2 PE=2 SV=2 451 525 5.0E-06
sp|Q5REN1|FBLI1_PONAB Filamin-binding LIM protein 1 OS=Pongo abelii GN=FBLIM1 PE=2 SV=1 450 556 5.0E-06
sp|A8DZE6|WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio GN=wtip PE=3 SV=1 427 551 6.0E-06
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 447 539 6.0E-06
sp|P53407|ISL2B_DANRE Insulin gene enhancer protein isl-2b OS=Danio rerio GN=isl2b PE=2 SV=1 428 541 6.0E-06
sp|Q8WUP2|FBLI1_HUMAN Filamin-binding LIM protein 1 OS=Homo sapiens GN=FBLIM1 PE=1 SV=2 450 556 6.0E-06
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 428 575 7.0E-06
sp|Q90WV2|PRI1B_XENLA Prickle-like protein 1-B OS=Xenopus laevis GN=prickle1-b PE=2 SV=2 396 538 7.0E-06
sp|Q90Z06|PRI1A_XENLA Prickle-like protein 1-A OS=Xenopus laevis GN=prickle1-a PE=1 SV=1 396 538 7.0E-06
sp|Q68G74|LHX8_HUMAN LIM/homeobox protein Lhx8 OS=Homo sapiens GN=LHX8 PE=1 SV=2 423 538 7.0E-06
sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 428 527 8.0E-06
sp|Q7TQJ8|WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus GN=Wtip PE=1 SV=1 427 525 8.0E-06
sp|Q71QF9|PRIC1_RAT Prickle-like protein 1 OS=Rattus norvegicus GN=Prickle1 PE=2 SV=2 396 538 8.0E-06
sp|Q6DJ06|LMO42_XENTR LIM domain transcription factor LMO4.2 OS=Xenopus tropicalis GN=lmo4.2 PE=2 SV=1 416 541 8.0E-06
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 437 538 9.0E-06
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 437 538 9.0E-06
sp|Q96A47|ISL2_HUMAN Insulin gene enhancer protein ISL-2 OS=Homo sapiens GN=ISL2 PE=1 SV=1 428 528 9.0E-06
sp|Q9U1I1|ESN_DROME Protein espinas OS=Drosophila melanogaster GN=esn PE=2 SV=1 399 538 9.0E-06
sp|Q9CXV0|ISL2_MOUSE Insulin gene enhancer protein ISL-2 OS=Mus musculus GN=Isl2 PE=1 SV=2 428 528 9.0E-06
sp|P50212|ISL2B_ONCTS Insulin gene enhancer protein ISL-2B (Fragment) OS=Oncorhynchus tshawytscha GN=isl2b PE=2 SV=1 428 541 1.0E-05
sp|P61969|LMO4_MOUSE LIM domain transcription factor LMO4 OS=Mus musculus GN=Lmo4 PE=1 SV=1 416 541 1.0E-05
sp|P61968|LMO4_HUMAN LIM domain transcription factor LMO4 OS=Homo sapiens GN=LMO4 PE=1 SV=1 416 541 1.0E-05
sp|Q3SWZ8|LMO4_BOVIN LIM domain transcription factor LMO4 OS=Bos taurus GN=LMO4 PE=2 SV=1 416 541 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2360
MGDHVCDGAGAEVAPPPEVEKSHGQPLQSKFGRMPPQVDTSAANRPYMHRGQLTPVSQPSDSRSVSPVIHNGGPS
PSLSDDMFAGSSPATARRPGGYGGFNRADGDEGEADEGAVGRMKDRIKALVPGPFDSGLRLATSYSGRQDALPSP
DEMGRAMDHYRPGTAGSPVHDGPRPVMTPPKVPRKNGYGGFGPPATVLAEPASPSGYIGRSETFPLPSPRLEQAP
RLASSNAAGEDGERKKSMGPDRTRKPPPRISLLTQHRPRHASSSVDLAAEFGIGNPYSTSAGSPSPTPSPFGGSY
ASPISTSTVTSPAPSPRSPSSPRLQKPVDGKLRKAASPRLDRFDPAVQSGQAEGPVSPTLLSPRKKQGGGLMGLF
RDRDRERDRERERQRQRDGDRELERERQKERVKARARADAPLPAPALPYRGECKACGLAIRGKSISSADGRLSGK
YHKACFVCTTCTEPFLSTEFYVLGDHPYCEQHYHKLNGSLCGSCGRGIEGQYLEDEARTKYHLGCFRCLDCHMSL
VDGYFEVDGRAYCERDAYSRSAPLPPDLDMPSPRTRLPPRGPAGLPGRPAPRPAATRPPPVSGKRLAPAMGFPPR
PRMNKRMTRLGQM*
Coding >OphauG2|2360
ATGGGAGACCACGTGTGTGACGGAGCGGGAGCCGAAGTAGCGCCTCCGCCAGAGGTGGAAAAGAGCCACGGCCAG
CCTCTGCAGTCAAAGTTTGGGCGCATGCCGCCACAGGTCGACACCAGTGCTGCGAATCGACCGTATATGCACCGC
GGCCAGTTGACGCCCGTTAGCCAGCCAAGTGACTCGCGCAGCGTGTCGCCCGTAATACACAATGGAGGACCATCG
CCCAGTCTTAGCGACGACATGTTTGCTGGGTCGTCGCCAGCCACGGCGAGACGGCCGGGCGGCTATGGCGGATTC
AACAGGGCCGACGGCGACGAGGGCGAGGCCGACGAGGGCGCCGTGGGGCGAATGAAGGATCGCATCAAGGCCCTG
GTGCCCGGGCCCTTTGACAGCGGGCTGCGACTGGCCACGTCGTACAGCGGCCGACAAGACGCATTGCCGTCGCCC
GACGAGATGGGGCGGGCCATGGACCACTACCGGCCAGGGACGGCTGGCAGCCCAGTGCACGATGGGCCCAGGCCC
GTCATGACACCACCCAAGGTGCCGAGGAAGAACGGCTATGGAGGCTTCGGGCCGCCAGCGACTGTGCTTGCCGAG
CCGGCGTCGCCGTCGGGATACATTGGCAGATCCGAGACGTTTCCGCTGCCGTCGCCGCGGCTGGAGCAGGCGCCC
AGGCTGGCGTCGAGCAACGCGGCGGGCGAGGATGGCGAGCGGAAAAAGTCCATGGGGCCGGACCGGACGCGCAAG
CCGCCGCCTCGCATCAGCCTGCTGACCCAGCACCGGCCGCGGCACGCGTCGTCGTCGGTGGATCTGGCGGCCGAG
TTTGGCATCGGGAACCCGTACAGCACGTCGGCCGGGTCGCCGTCGCCCACGCCGTCGCCCTTTGGCGGCAGCTAT
GCCAGTCCCATCAGCACCAGCACCGTCACCAGCCCCGCGCCGTCGCCGCGCAGTCCGTCGTCGCCGCGGCTGCAG
AAGCCCGTGGACGGCAAGCTGCGCAAGGCGGCGTCGCCGCGACTGGACCGGTTCGACCCTGCGGTGCAATCGGGC
CAGGCCGAGGGGCCCGTGTCGCCCACGCTGCTGTCGCCGCGCAAGAAGCAGGGCGGGGGTCTGATGGGGCTCTTC
CGCGACCGCGACCGTGAGCGCGACCGTGAGCGCGAGCGCCAGCGCCAGCGAGACGGCGACAGGGAGCTGGAGCGC
GAGCGGCAAAAGGAGCGAGTCAAGGCCAGAGCCAGGGCCGACGCTCCTCTGCCCGCCCCCGCCCTGCCCTATCGC
GGCGAGTGCAAGGCCTGCGGACTGGCCATCCGCGGCAAGAGCATCTCGTCGGCCGACGGGCGCCTCTCGGGCAAG
TATCACAAGGCCTGCTTCGTCTGCACAACCTGCACCGAGCCCTTCCTCTCCACCGAGTTCTACGTGCTCGGCGAC
CATCCCTACTGCGAACAGCACTATCACAAGCTCAACGGCAGCCTGTGCGGCAGCTGCGGCCGCGGCATCGAGGGC
CAGTATCTCGAGGACGAGGCCCGCACCAAGTACCACCTGGGCTGCTTCCGCTGCCTCGACTGCCACATGTCGCTC
GTCGACGGCTACTTCGAGGTCGACGGCCGCGCCTATTGCGAGCGCGACGCCTACAGCCGCTCCGCCCCGCTGCCC
CCCGACTTGGACATGCCCTCGCCTCGCACTCGTCTGCCGCCCAGGGGCCCGGCTGGCCTGCCTGGCCGTCCAGCG
CCTCGCCCTGCTGCCACGCGGCCCCCCCCCGTGTCGGGCAAACGTCTGGCGCCTGCAATGGGCTTCCCTCCGCGC
CCGCGGATGAACAAGCGTATGACGCGGCTGGGGCAAATGTGA
Transcript >OphauG2|2360
ATGGGAGACCACGTGTGTGACGGAGCGGGAGCCGAAGTAGCGCCTCCGCCAGAGGTGGAAAAGAGCCACGGCCAG
CCTCTGCAGTCAAAGTTTGGGCGCATGCCGCCACAGGTCGACACCAGTGCTGCGAATCGACCGTATATGCACCGC
GGCCAGTTGACGCCCGTTAGCCAGCCAAGTGACTCGCGCAGCGTGTCGCCCGTAATACACAATGGAGGACCATCG
CCCAGTCTTAGCGACGACATGTTTGCTGGGTCGTCGCCAGCCACGGCGAGACGGCCGGGCGGCTATGGCGGATTC
AACAGGGCCGACGGCGACGAGGGCGAGGCCGACGAGGGCGCCGTGGGGCGAATGAAGGATCGCATCAAGGCCCTG
GTGCCCGGGCCCTTTGACAGCGGGCTGCGACTGGCCACGTCGTACAGCGGCCGACAAGACGCATTGCCGTCGCCC
GACGAGATGGGGCGGGCCATGGACCACTACCGGCCAGGGACGGCTGGCAGCCCAGTGCACGATGGGCCCAGGCCC
GTCATGACACCACCCAAGGTGCCGAGGAAGAACGGCTATGGAGGCTTCGGGCCGCCAGCGACTGTGCTTGCCGAG
CCGGCGTCGCCGTCGGGATACATTGGCAGATCCGAGACGTTTCCGCTGCCGTCGCCGCGGCTGGAGCAGGCGCCC
AGGCTGGCGTCGAGCAACGCGGCGGGCGAGGATGGCGAGCGGAAAAAGTCCATGGGGCCGGACCGGACGCGCAAG
CCGCCGCCTCGCATCAGCCTGCTGACCCAGCACCGGCCGCGGCACGCGTCGTCGTCGGTGGATCTGGCGGCCGAG
TTTGGCATCGGGAACCCGTACAGCACGTCGGCCGGGTCGCCGTCGCCCACGCCGTCGCCCTTTGGCGGCAGCTAT
GCCAGTCCCATCAGCACCAGCACCGTCACCAGCCCCGCGCCGTCGCCGCGCAGTCCGTCGTCGCCGCGGCTGCAG
AAGCCCGTGGACGGCAAGCTGCGCAAGGCGGCGTCGCCGCGACTGGACCGGTTCGACCCTGCGGTGCAATCGGGC
CAGGCCGAGGGGCCCGTGTCGCCCACGCTGCTGTCGCCGCGCAAGAAGCAGGGCGGGGGTCTGATGGGGCTCTTC
CGCGACCGCGACCGTGAGCGCGACCGTGAGCGCGAGCGCCAGCGCCAGCGAGACGGCGACAGGGAGCTGGAGCGC
GAGCGGCAAAAGGAGCGAGTCAAGGCCAGAGCCAGGGCCGACGCTCCTCTGCCCGCCCCCGCCCTGCCCTATCGC
GGCGAGTGCAAGGCCTGCGGACTGGCCATCCGCGGCAAGAGCATCTCGTCGGCCGACGGGCGCCTCTCGGGCAAG
TATCACAAGGCCTGCTTCGTCTGCACAACCTGCACCGAGCCCTTCCTCTCCACCGAGTTCTACGTGCTCGGCGAC
CATCCCTACTGCGAACAGCACTATCACAAGCTCAACGGCAGCCTGTGCGGCAGCTGCGGCCGCGGCATCGAGGGC
CAGTATCTCGAGGACGAGGCCCGCACCAAGTACCACCTGGGCTGCTTCCGCTGCCTCGACTGCCACATGTCGCTC
GTCGACGGCTACTTCGAGGTCGACGGCCGCGCCTATTGCGAGCGCGACGCCTACAGCCGCTCCGCCCCGCTGCCC
CCCGACTTGGACATGCCCTCGCCTCGCACTCGTCTGCCGCCCAGGGGCCCGGCTGGCCTGCCTGGCCGTCCAGCG
CCTCGCCCTGCTGCCACGCGGCCCCCCCCCGTGTCGGGCAAACGTCTGGCGCCTGCAATGGGCTTCCCTCCGCGC
CCGCGGATGAACAAGCGTATGACGCGGCTGGGGCAAATGTGA
Gene >OphauG2|2360
ATGGGAGACCACGTGTGTGACGGAGCGGGAGCCGAAGGTGAGGCGTCTTGTTGAGAGTGGCTGGGTATGCCATGT
TTTGCTAATGCCATGAGCAGTAGCGCCTCCGCCAGAGGTGGAAAAGAGCCACGGCCAGCCTCTGCAGTCAAAGTT
TGGGCGCATGCCGCCACAGGTCGACACCAGTGCTGCGAGTAAGTTGCTGCGGTTCCGCAGAGGCGGCTCTCAACC
ATTCCAAGACGCATGTCAACTAAGACAGTCAACACAGATCGACCGTATATGCACCGCGGCCAGTTGACGCCCGTT
AGCCAGCCAAGTGACTCGCGCAGCGTGTCGCCCGTAATACACAATGGAGGACCATCGCCCAGTCTTAGCGACGAC
ATGTTTGCTGGGTCGTCGCCAGCCACGGCGAGACGGCCGGGCGGCTATGGCGGATTCAACAGGGCCGACGGCGAC
GAGGGCGAGGCCGACGAGGGCGCCGTGGGGCGAATGAAGGATCGCATCAAGGCCCTGGTGCCCGGGCCCTTTGAC
AGCGGGCTGCGACTGGCCACGTCGTACAGCGGCCGACAAGACGCATTGCCGTCGCCCGACGAGATGGGGCGGGCC
ATGGACCACTACCGGCCAGGGACGGCTGGCAGCCCAGTGCACGATGGGCCCAGGCCCGTCATGACACCACCCAAG
GTGCCGAGGAAGAACGGCTATGGAGGCTTCGGGCCGCCAGCGACTGTGCTTGCCGAGCCGGCGTCGCCGTCGGGA
TACATTGGCAGATCCGAGACGTTTCCGCTGCCGTCGCCGCGGCTGGAGCAGGCGCCCAGGCTGGCGTCGAGCAAC
GCGGCGGGCGAGGATGGCGAGCGGAAAAAGTCCATGGGGCCGGACCGGACGCGCAAGCCGCCGCCTCGCATCAGC
CTGCTGACCCAGCACCGGCCGCGGCACGCGTCGTCGTCGGTGGATCTGGCGGCCGAGTTTGGCATCGGGAACCCG
TACAGCACGTCGGCCGGGTCGCCGTCGCCCACGCCGTCGCCCTTTGGCGGCAGCTATGCCAGTCCCATCAGCACC
AGCACCGTCACCAGCCCCGCGCCGTCGCCGCGCAGTCCGTCGTCGCCGCGGCTGCAGAAGCCCGTGGACGGCAAG
CTGCGCAAGGCGGCGTCGCCGCGACTGGACCGGTTCGACCCTGCGGTGCAATCGGGCCAGGCCGAGGGGCCCGTG
TCGCCCACGCTGCTGTCGCCGCGCAAGAAGCAGGGCGGGGGTCTGATGGGGCTCTTCCGCGACCGCGACCGTGAG
CGCGACCGTGAGCGCGAGCGCCAGCGCCAGCGAGACGGCGACAGGGAGCTGGAGCGCGAGCGGCAAAAGGAGCGA
GTCAAGGCCAGAGCCAGGGCCGACGCTCCTCTGCCCGCCCCCGCCCTGCCCTATCGCGGCGAGTGCAAGGCCTGC
GGACTGGCCATCCGCGGCAAGAGCATCTCGTCGGCCGACGGGCGCCTCTCGGGCAAGTATCACAAGGCCTGCTTC
GTCTGCACAACCTGCACCGAGCCCTTCCTCTCCACCGAGTTCTACGTGCTCGGCGACCATCCCTACTGCGAACAG
CACTATCACAAGCTCAACGGCAGCCTGTGCGGCAGCTGCGGCCGCGGCATCGAGGGCCAGTATCTCGAGGACGAG
GCCCGCACCAAGTACCACCTGGGCTGCTTCCGCTGCCTCGACTGCCACATGTCGCTCGTCGACGGCTACTTCGAG
GTCGACGGCCGCGCCTATTGCGAGCGCGACGCCTACAGCCGCTCCGCCCCGCTGCCCCCCGACTTGGACATGCCC
TCGCCTCGCACTCGTCTGCCGCCCAGGGGCCCGGCTGGCCTGCCTGGCCGTCCAGCGCCTCGCCCTGCTGCCACG
CGGCCCCCCCCCGTGTCGGGCAAACGTCTGGCGCCTGCAATGGGCTTCCCTCCGCGCCCGCGGATGAACAAGCGT
ATGACGCGGCTGGGGCAAATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail