Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2355
Gene name
LocationContig_1838:158..1061
Strand-
Gene length (bp)903
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F2SCC4|SMD_TRIRC Sphingomyelinase D OS=Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) GN=TERG_01406 PE=3 SV=1 34 300 2.0E-78
sp|D4AZV8|SMD_ARTBC Sphingomyelinase D OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01728 PE=3 SV=1 30 300 4.0E-74
sp|Q59332|PLD_CORUL Phospholipase D OS=Corynebacterium ulcerans GN=pld PE=3 SV=1 1 300 1.0E-65
sp|Q59121|PLD_ARCHD Phospholipase D OS=Arcanobacterium haemolyticum (strain ATCC 9345 / DSM 20595 / NBRC 15585 / NCTC 8452 / 11018) GN=pld PE=3 SV=2 4 300 1.0E-64
sp|P20626|PLD_CORPS Phospholipase D OS=Corynebacterium pseudotuberculosis GN=pld PE=1 SV=1 1 300 1.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F2SCC4|SMD_TRIRC Sphingomyelinase D OS=Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) GN=TERG_01406 PE=3 SV=1 34 300 2.0E-78
sp|D4AZV8|SMD_ARTBC Sphingomyelinase D OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01728 PE=3 SV=1 30 300 4.0E-74
sp|Q59332|PLD_CORUL Phospholipase D OS=Corynebacterium ulcerans GN=pld PE=3 SV=1 1 300 1.0E-65
sp|Q59121|PLD_ARCHD Phospholipase D OS=Arcanobacterium haemolyticum (strain ATCC 9345 / DSM 20595 / NBRC 15585 / NCTC 8452 / 11018) GN=pld PE=3 SV=2 4 300 1.0E-64
sp|P20626|PLD_CORPS Phospholipase D OS=Corynebacterium pseudotuberculosis GN=pld PE=1 SV=1 1 300 1.0E-63
sp|C4JUE5|SMD_UNCRE Sphingomyelinase D OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_04748 PE=3 SV=1 36 300 3.0E-59
sp|J3K844|SMD_COCIM Sphingomyelinase D OS=Coccidioides immitis (strain RS) GN=CIMG_06182 PE=3 SV=1 36 300 4.0E-58
sp|B8NQ51|SMD_ASPFN Sphingomyelinase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_004420 PE=1 SV=1 8 300 3.0E-56
sp|C0NUU1|SMD_AJECG Sphingomyelinase D OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_06705 PE=3 SV=1 3 300 5.0E-53
sp|C0S3M9|SMD_PARBP Sphingomyelinase D OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02293 PE=3 SV=1 36 266 1.0E-48
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999369

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup36
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2355 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|7838
Ophiocordyceps australis 1348a (Ghana) OphauG2|6039
Ophiocordyceps australis map64 (Brazil) OphauB2|121
Ophiocordyceps australis map64 (Brazil) OphauB2|6470
Ophiocordyceps australis map64 (Brazil) OphauB2|966
Ophiocordyceps camponoti-floridani Ophcf2|03951
Ophiocordyceps camponoti-floridani Ophcf2|00019
Ophiocordyceps camponoti-rufipedis Ophun1|2814
Ophiocordyceps camponoti-rufipedis Ophun1|3653
Ophiocordyceps camponoti-rufipedis Ophun1|3154
Ophiocordyceps kimflemingae Ophio5|7975
Ophiocordyceps subramaniannii Hirsu2|7387
Ophiocordyceps subramaniannii Hirsu2|5419
Ophiocordyceps subramaniannii Hirsu2|518
Ophiocordyceps subramaniannii Hirsu2|3897
Ophiocordyceps subramaniannii Hirsu2|3863

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2355
MSFKTAAALSLLAAQLAPVSSCPITHAIKRQDGDAKPFWAIAHRVLVKAGVQAAVSHGANALEVDVQPWNDQWWA
DHDGTPASAGDTIQQLFQTIATERADGANIAFVWLDIKSPDYCDAAQDNCNIEALQRQARATLEPAGIKVLYGFY
NDKGRAYQVIRDSLNENEAINQDGKAGDVQASFENDGPSDVAKRVLSKGLFSPRLVFGNCQDDGWMCSQLRQGVE
SKAFGKVFGWTFPNDQGDLMGRVIDEAHVDGLIYGNGASHYTDAANLRELATTLHGLIDNTGGKVRMATLEDVPW
*
Coding >OphauG2|2355
ATGTCCTTCAAAACCGCTGCTGCCCTATCCCTTCTGGCCGCCCAGCTCGCCCCCGTGTCCTCCTGCCCCATCACC
CATGCCATCAAACGCCAAGACGGCGACGCCAAGCCCTTCTGGGCCATTGCCCACCGCGTCCTAGTCAAGGCCGGC
GTGCAAGCCGCCGTCAGCCACGGCGCCAACGCCCTCGAAGTCGACGTCCAGCCATGGAACGACCAATGGTGGGCC
GACCACGACGGCACGCCCGCCAGCGCCGGCGACACCATCCAGCAACTCTTCCAAACCATTGCCACGGAGCGCGCC
GACGGCGCAAACATTGCCTTTGTGTGGCTCGACATCAAGAGCCCCGACTACTGCGACGCCGCCCAGGACAACTGC
AACATTGAGGCGCTGCAGCGACAGGCCCGCGCCACGCTGGAACCCGCGGGCATCAAGGTGCTCTACGGCTTCTAC
AACGACAAGGGCCGCGCGTACCAAGTCATTCGCGACAGCTTGAATGAAAACGAGGCGATTAACCAGGATGGGAAG
GCGGGAGACGTGCAGGCGTCGTTTGAAAATGACGGGCCGAGTGATGTGGCCAAGCGCGTCTTGAGCAAAGGCTTG
TTTTCGCCGCGCTTGGTGTTTGGGAATTGCCAGGACGATGGGTGGATGTGCTCGCAGCTGCGACAGGGCGTCGAG
TCCAAGGCCTTTGGAAAGGTGTTTGGATGGACGTTTCCGAATGATCAGGGGGACTTGATGGGGCGGGTGATTGAC
GAGGCGCATGTGGACGGGCTGATTTATGGGAACGGGGCGTCGCACTATACGGATGCTGCAAACTTGAGGGAGCTG
GCGACGACTCTGCATGGGCTGATTGACAATACGGGGGGCAAGGTGCGGATGGCTACGCTGGAGGATGTGCCGTGG
TAG
Transcript >OphauG2|2355
ATGTCCTTCAAAACCGCTGCTGCCCTATCCCTTCTGGCCGCCCAGCTCGCCCCCGTGTCCTCCTGCCCCATCACC
CATGCCATCAAACGCCAAGACGGCGACGCCAAGCCCTTCTGGGCCATTGCCCACCGCGTCCTAGTCAAGGCCGGC
GTGCAAGCCGCCGTCAGCCACGGCGCCAACGCCCTCGAAGTCGACGTCCAGCCATGGAACGACCAATGGTGGGCC
GACCACGACGGCACGCCCGCCAGCGCCGGCGACACCATCCAGCAACTCTTCCAAACCATTGCCACGGAGCGCGCC
GACGGCGCAAACATTGCCTTTGTGTGGCTCGACATCAAGAGCCCCGACTACTGCGACGCCGCCCAGGACAACTGC
AACATTGAGGCGCTGCAGCGACAGGCCCGCGCCACGCTGGAACCCGCGGGCATCAAGGTGCTCTACGGCTTCTAC
AACGACAAGGGCCGCGCGTACCAAGTCATTCGCGACAGCTTGAATGAAAACGAGGCGATTAACCAGGATGGGAAG
GCGGGAGACGTGCAGGCGTCGTTTGAAAATGACGGGCCGAGTGATGTGGCCAAGCGCGTCTTGAGCAAAGGCTTG
TTTTCGCCGCGCTTGGTGTTTGGGAATTGCCAGGACGATGGGTGGATGTGCTCGCAGCTGCGACAGGGCGTCGAG
TCCAAGGCCTTTGGAAAGGTGTTTGGATGGACGTTTCCGAATGATCAGGGGGACTTGATGGGGCGGGTGATTGAC
GAGGCGCATGTGGACGGGCTGATTTATGGGAACGGGGCGTCGCACTATACGGATGCTGCAAACTTGAGGGAGCTG
GCGACGACTCTGCATGGGCTGATTGACAATACGGGGGGCAAGGTGCGGATGGCTACGCTGGAGGATGTGCCGTGG
TAG
Gene >OphauG2|2355
ATGTCCTTCAAAACCGCTGCTGCCCTATCCCTTCTGGCCGCCCAGCTCGCCCCCGTGTCCTCCTGCCCCATCACC
CATGCCATCAAACGCCAAGACGGCGACGCCAAGCCCTTCTGGGCCATTGCCCACCGCGTCCTAGTCAAGGCCGGC
GTGCAAGCCGCCGTCAGCCACGGCGCCAACGCCCTCGAAGTCGACGTCCAGCCATGGAACGACCAATGGTGGGCC
GACCACGACGGCACGCCCGCCAGCGCCGGCGACACCATCCAGCAACTCTTCCAAACCATTGCCACGGAGCGCGCC
GACGGCGCAAACATTGCCTTTGTGTGGCTCGACATCAAGAGCCCCGACTACTGCGACGCCGCCCAGGACAACTGC
AACATTGAGGCGCTGCAGCGACAGGCCCGCGCCACGCTGGAACCCGCGGGCATCAAGGTGCTCTACGGCTTCTAC
AACGACAAGGGCCGCGCGTACCAAGTCATTCGCGACAGCTTGAATGAAAACGAGGCGATTAACCAGGATGGGAAG
GCGGGAGACGTGCAGGCGTCGTTTGAAAATGACGGGCCGAGTGATGTGGCCAAGCGCGTCTTGAGCAAAGGCTTG
TTTTCGCCGCGCTTGGTGTTTGGGAATTGCCAGGACGATGGGTGGATGTGCTCGCAGCTGCGACAGGGCGTCGAG
TCCAAGGCCTTTGGAAAGGTGTTTGGATGGACGTTTCCGAATGATCAGGGGGACTTGATGGGGCGGGTGATTGAC
GAGGCGCATGTGGACGGGCTGATTTATGGGAACGGGGCGTCGCACTATACGGATGCTGCAAACTTGAGGGAGCTG
GCGACGACTCTGCATGGGCTGATTGACAATACGGGGGGCAAGGTGCGGATGGCTACGCTGGAGGATGTGCCGTGG
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail