Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2354
Gene name
LocationContig_1837:200..1373
Strand-
Gene length (bp)1173
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09362 DUF1996 Domain of unknown function (DUF1996) 2.5E-63 42 304

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999548

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2558
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2354 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5163
Ophiocordyceps camponoti-floridani Ophcf2|06513
Ophiocordyceps camponoti-rufipedis Ophun1|5610
Ophiocordyceps kimflemingae Ophio5|6612
Ophiocordyceps subramaniannii Hirsu2|3803

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2354
MRFAAVTALVAAAANGVSAAKDQRSFAVLRFNNKQLTKTRADPIVNPGRPATHVHHVLGGSGFGLESTGKQLSRS
RCSTALVKGDNSNYWFPSLYFQDDKTAKFEHVDVFYTNVYYFFEPTNDHIRAFPLGLSILVGDPDTRSPPAGGAH
SNLDPSKGPVNPLKWICARRHGDAAGPSWPRHSDGHTAGMVDPGNRGEGVGFPDVDCDGYASPLRADVHFPSCYN
PRAGLKNYTSNMAFPTDSGNGKMDCPPGWIHVPHLFYEVYFDTPAFNHRWAQGKGHQPFVVSNGDATGYSFHADF
MAGWDEKLLQHIIDTCDAGTAGMDKCPGLSNGLNHGDSCTIRSPVNEKVDGVLTSLPGGPKVTGWGVESHSKQPS
EHDADEQDDDDDGSA*
Coding >OphauG2|2354
ATGAGATTTGCAGCCGTCACTGCACTCGTGGCAGCCGCAGCCAATGGCGTCTCTGCCGCCAAGGACCAGCGCTCC
TTTGCCGTGCTGCGCTTCAACAACAAGCAGCTCACCAAGACTCGCGCAGACCCCATTGTCAACCCCGGCCGCCCG
GCCACACACGTCCATCATGTTCTAGGCGGCAGCGGCTTTGGCCTCGAGTCAACGGGCAAGCAGCTGAGCAGGTCG
CGCTGCAGCACTGCCCTCGTCAAAGGCGACAACAGCAACTACTGGTTTCCCTCGCTTTACTTCCAAGACGACAAG
ACGGCCAAGTTTGAGCATGTCGACGTCTTCTACACCAATGTATACTACTTTTTCGAGCCCACAAATGACCACATC
CGAGCCTTTCCCCTCGGCCTCAGCATTCTTGTCGGCGACCCAGACACTCGCTCTCCTCCTGCCGGCGGTGCCCAT
TCCAACCTGGATCCCTCCAAAGGCCCCGTCAACCCTCTCAAATGGATCTGCGCCCGCCGTCATGGCGACGCCGCT
GGGCCGTCGTGGCCTCGGCACTCTGATGGCCACACAGCCGGCATGGTCGATCCGGGTAATAGGGGCGAGGGCGTC
GGCTTCCCTGATGTTGACTGCGATGGCTACGCCTCGCCGCTTCGTGCCGACGTGCACTTTCCCTCGTGCTACAAT
CCACGTGCCGGTCTGAAGAACTACACGTCCAACATGGCCTTTCCCACCGACTCTGGCAATGGCAAGATGGACTGC
CCGCCAGGCTGGATTCACGTTCCGCACTTGTTTTATGAAGTATACTTTGACACGCCCGCCTTCAACCACCGCTGG
GCACAGGGCAAAGGCCACCAGCCCTTTGTCGTGTCCAACGGCGACGCCACGGGCTACAGCTTCCACGCCGACTTT
ATGGCCGGCTGGGACGAGAAGCTGCTGCAGCACATCATCGACACGTGCGATGCGGGCACCGCCGGCATGGACAAG
TGTCCCGGCCTGTCCAATGGTCTGAACCATGGCGACTCGTGCACCATCAGGTCGCCCGTCAACGAAAAGGTGGAT
GGCGTCTTGACCTCTCTGCCTGGAGGCCCCAAAGTCACTGGATGGGGGGTTGAATCGCACTCGAAACAGCCGAGT
GAGCATGATGCTGATGAGCAAGATGATGATGATGATGGCTCGGCCTAG
Transcript >OphauG2|2354
ATGAGATTTGCAGCCGTCACTGCACTCGTGGCAGCCGCAGCCAATGGCGTCTCTGCCGCCAAGGACCAGCGCTCC
TTTGCCGTGCTGCGCTTCAACAACAAGCAGCTCACCAAGACTCGCGCAGACCCCATTGTCAACCCCGGCCGCCCG
GCCACACACGTCCATCATGTTCTAGGCGGCAGCGGCTTTGGCCTCGAGTCAACGGGCAAGCAGCTGAGCAGGTCG
CGCTGCAGCACTGCCCTCGTCAAAGGCGACAACAGCAACTACTGGTTTCCCTCGCTTTACTTCCAAGACGACAAG
ACGGCCAAGTTTGAGCATGTCGACGTCTTCTACACCAATGTATACTACTTTTTCGAGCCCACAAATGACCACATC
CGAGCCTTTCCCCTCGGCCTCAGCATTCTTGTCGGCGACCCAGACACTCGCTCTCCTCCTGCCGGCGGTGCCCAT
TCCAACCTGGATCCCTCCAAAGGCCCCGTCAACCCTCTCAAATGGATCTGCGCCCGCCGTCATGGCGACGCCGCT
GGGCCGTCGTGGCCTCGGCACTCTGATGGCCACACAGCCGGCATGGTCGATCCGGGTAATAGGGGCGAGGGCGTC
GGCTTCCCTGATGTTGACTGCGATGGCTACGCCTCGCCGCTTCGTGCCGACGTGCACTTTCCCTCGTGCTACAAT
CCACGTGCCGGTCTGAAGAACTACACGTCCAACATGGCCTTTCCCACCGACTCTGGCAATGGCAAGATGGACTGC
CCGCCAGGCTGGATTCACGTTCCGCACTTGTTTTATGAAGTATACTTTGACACGCCCGCCTTCAACCACCGCTGG
GCACAGGGCAAAGGCCACCAGCCCTTTGTCGTGTCCAACGGCGACGCCACGGGCTACAGCTTCCACGCCGACTTT
ATGGCCGGCTGGGACGAGAAGCTGCTGCAGCACATCATCGACACGTGCGATGCGGGCACCGCCGGCATGGACAAG
TGTCCCGGCCTGTCCAATGGTCTGAACCATGGCGACTCGTGCACCATCAGGTCGCCCGTCAACGAAAAGGTGGAT
GGCGTCTTGACCTCTCTGCCTGGAGGCCCCAAAGTCACTGGATGGGGGGTTGAATCGCACTCGAAACAGCCGAGT
GAGCATGATGCTGATGAGCAAGATGATGATGATGATGGCTCGGCCTAG
Gene >OphauG2|2354
ATGAGATTTGCAGCCGTCACTGCACTCGTGGCAGCCGCAGCCAATGGCGTCTCTGCCGCCAAGGACCAGCGCTCC
TTTGCCGTGCTGCGCTTCAACAACAAGCAGCTCACCAAGACTCGCGCAGACCCCATTGTCAACCCCGGCCGCCCG
GCCACACACGTCCATCATGTTCTAGGCGGCAGCGGCTTTGGCCTCGAGTCAACGGGCAAGCAGCTGAGCAGGTCG
CGCTGCAGCACTGCCCTCGTCAAAGGCGACAACAGCAACTACTGGTTTCCCTCGCTTTACTTCCAAGACGACAAG
ACGGCCAAGTTTGAGCATGTCGACGTCTTCTACACCAATGTATACTACTTTTTCGAGCCCACAAATGACCACATC
CGAGCCTTTCCCCTCGGCCTCAGCATTCTTGTCGGCGACCCAGACACTCGCTCTCCTCCTGCCGGCGGTGCCCAT
TCCAACCTGGATCCCTCCAAAGGCCCCGTCAACCCTCTCAAATGGATCTGCGCCCGCCGTCATGGCGACGCCGCT
GGGCCGTCGTGGCCTCGGCACTCTGATGGCCACACAGCCGGCATGGTCGATCCGGGTAATAGGGGCGAGGGCGTC
GGCTTCCCTGATGTTGACTGCGATGGCTACGCCTCGCCGCTTCGTGCCGACGTGCACTTTCCCTCGTGCTACAAT
CCACGTGCCGGTCTGAAGAACTACACGTCCAACATGGCCTTTCCCACCGACTCTGGCAATGGCAAGATGGACTGC
CCGCCAGGCTGGATTCACGTTCCGCACTTGTTTTATGAAGTATACTTTGACACGCCCGCCTTCAACCACCGCTGG
GCACAGGGCAAAGGCCACCAGCCCTTTGTCGTGTCCAACGGCGACGCCACGGGCTACAGCTTCCACGCCGACTTT
ATGGCCGGCTGGGACGAGAAGCTGCTGCAGCACATCATCGACACGTGCGATGCGGGCACCGCCGGCATGGACAAG
TGTCCCGGCCTGTCCAATGGTCTGAACCATGGCGACTCGTGCACCATCAGGTCGCCCGTCAACGAAAAGGTGGAT
GGCGTCTTGACCTCTCTGCCTGGAGGCCCCAAAGTCACTGGATGGGGGGTTGAATCGCACTCGAAACAGCCGAGT
GAGCATGATGCTGATGAGCAAGATGATGATGATGATGGCTCGGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail