Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2348
Gene name
LocationContig_1830:1004..1843
Strand-
Gene length (bp)839
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13622 4HBT_3 Thioesterase-like superfamily 1.4E-58 3 245
PF02551 Acyl_CoA_thio Acyl-CoA thioesterase 1.0E-11 184 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P58137|ACOT8_MOUSE Acyl-coenzyme A thioesterase 8 OS=Mus musculus GN=Acot8 PE=1 SV=1 4 255 5.0E-33
sp|Q8VHK0|ACOT8_RAT Acyl-coenzyme A thioesterase 8 OS=Rattus norvegicus GN=Acot8 PE=2 SV=1 4 255 8.0E-32
sp|O14734|ACOT8_HUMAN Acyl-coenzyme A thioesterase 8 OS=Homo sapiens GN=ACOT8 PE=1 SV=1 5 255 1.0E-30
sp|P0AGG2|TESB_ECOLI Acyl-CoA thioesterase 2 OS=Escherichia coli (strain K12) GN=tesB PE=1 SV=2 2 246 1.0E-15
sp|P0AGG3|TESB_ECO57 Acyl-CoA thioesterase 2 OS=Escherichia coli O157:H7 GN=tesB PE=3 SV=2 2 246 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P58137|ACOT8_MOUSE Acyl-coenzyme A thioesterase 8 OS=Mus musculus GN=Acot8 PE=1 SV=1 4 255 5.0E-33
sp|Q8VHK0|ACOT8_RAT Acyl-coenzyme A thioesterase 8 OS=Rattus norvegicus GN=Acot8 PE=2 SV=1 4 255 8.0E-32
sp|O14734|ACOT8_HUMAN Acyl-coenzyme A thioesterase 8 OS=Homo sapiens GN=ACOT8 PE=1 SV=1 5 255 1.0E-30
sp|P0AGG2|TESB_ECOLI Acyl-CoA thioesterase 2 OS=Escherichia coli (strain K12) GN=tesB PE=1 SV=2 2 246 1.0E-15
sp|P0AGG3|TESB_ECO57 Acyl-CoA thioesterase 2 OS=Escherichia coli O157:H7 GN=tesB PE=3 SV=2 2 246 1.0E-15
sp|P44498|TESB_HAEIN Acyl-CoA thioesterase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tesB PE=3 SV=1 5 247 7.0E-12
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6844
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2348 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5112
Ophiocordyceps kimflemingae Ophio5|7271

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2348
MADTPILYHVERVRDGRSYSTRTVQARQRGRCIFTTTVSFVRAAAAKTPQLRHAVSLPPGIVAPPDQYSPPPDES
FLRSGPFETAQSQVVLLPDLAACRCRQWMRARGSISAAGGRAAHLDALAYMSDSYFIGTISRIHRVWRWPFGPHQ
LADLPDDAKAHITRINQLEGMGAGPQQWAARPVAGMMVSLDHSIYFHEPLRVRADEWMFVEMDSPWAGDGRGVVM
QRIFAKDGTLLATCVQEGVIRLKPDGTEASSKL*
Coding >OphauG2|2348
ATGGCCGACACGCCCATTCTGTACCACGTGGAGCGGGTGCGCGACGGCCGCTCGTACTCGACGCGCACGGTGCAG
GCTCGGCAGCGAGGCCGGTGCATCTTCACCACCACAGTCAGCTTTGTGCGCGCCGCCGCCGCAAAGACGCCCCAG
CTGCGCCACGCCGTGTCGCTCCCCCCCGGCATCGTGGCGCCGCCCGACCAGTACTCGCCGCCGCCCGACGAAAGC
TTCCTGCGCTCGGGGCCCTTTGAGACGGCCCAGAGCCAGGTGGTGTTGCTGCCCGACCTGGCCGCCTGCCGCTGC
CGCCAGTGGATGCGCGCCCGCGGCTCCATCTCCGCCGCCGGCGGCCGCGCTGCCCACCTGGATGCCCTGGCCTAC
ATGTCGGACAGCTACTTTATCGGCACCATTTCCCGCATCCACCGCGTCTGGCGCTGGCCCTTTGGCCCGCACCAG
CTGGCCGACCTGCCCGACGATGCCAAGGCCCACATCACCCGCATCAACCAGCTCGAGGGCATGGGCGCTGGCCCC
CAGCAATGGGCTGCCCGCCCCGTCGCCGGCATGATGGTCAGCCTGGACCACAGCATCTACTTCCACGAGCCCTTG
CGTGTCAGGGCCGACGAGTGGATGTTTGTCGAGATGGACAGTCCCTGGGCCGGCGACGGCCGCGGTGTGGTGATG
CAGCGCATCTTTGCAAAGGACGGCACGCTGCTGGCCACGTGTGTGCAAGAGGGCGTCATACGGCTCAAGCCCGAC
GGCACCGAGGCTAGTTCCAAGCTGTAA
Transcript >OphauG2|2348
ATGGCCGACACGCCCATTCTGTACCACGTGGAGCGGGTGCGCGACGGCCGCTCGTACTCGACGCGCACGGTGCAG
GCTCGGCAGCGAGGCCGGTGCATCTTCACCACCACAGTCAGCTTTGTGCGCGCCGCCGCCGCAAAGACGCCCCAG
CTGCGCCACGCCGTGTCGCTCCCCCCCGGCATCGTGGCGCCGCCCGACCAGTACTCGCCGCCGCCCGACGAAAGC
TTCCTGCGCTCGGGGCCCTTTGAGACGGCCCAGAGCCAGGTGGTGTTGCTGCCCGACCTGGCCGCCTGCCGCTGC
CGCCAGTGGATGCGCGCCCGCGGCTCCATCTCCGCCGCCGGCGGCCGCGCTGCCCACCTGGATGCCCTGGCCTAC
ATGTCGGACAGCTACTTTATCGGCACCATTTCCCGCATCCACCGCGTCTGGCGCTGGCCCTTTGGCCCGCACCAG
CTGGCCGACCTGCCCGACGATGCCAAGGCCCACATCACCCGCATCAACCAGCTCGAGGGCATGGGCGCTGGCCCC
CAGCAATGGGCTGCCCGCCCCGTCGCCGGCATGATGGTCAGCCTGGACCACAGCATCTACTTCCACGAGCCCTTG
CGTGTCAGGGCCGACGAGTGGATGTTTGTCGAGATGGACAGTCCCTGGGCCGGCGACGGCCGCGGTGTGGTGATG
CAGCGCATCTTTGCAAAGGACGGCACGCTGCTGGCCACGTGTGTGCAAGAGGGCGTCATACGGCTCAAGCCCGAC
GGCACCGAGGCTAGTTCCAAGCTGTAA
Gene >OphauG2|2348
ATGGCCGACACGCCCATTCTGTACCACGTGGAGCGGGTGCGCGACGGCCGCTCGTACTCGACGCGCACGGTGCAG
GCTCGGCAGCGAGGCCGGTGCATCTTCACCACCACAGTCAGCTTTGTGCGCGCCGCCGCCGCAAAGACGCCCCAG
CTGCGCCACGCCGTGTCGCTCCCCCCCGGCATCGTGGCGCCGCCCGACCAGTACTCGCCGCCGCCCGACGAAAGC
TTCCTGCGCTCGGGGCCCTTTGAGACGGCCCAGAGCCAGGTGGTGTTGCTGCCCGACCTGGCCGCCTGCCGCTGC
CGCCAGTGGATGCGCGCCCGCGGCTCCATCTCCGCCGCCGGCGGCCGCGCTGCCCACCTGGATGCCCTGGCCTAC
ATGTCGGACAGCTACTTTATCGGCACCATTTCCCGCATCCACCGCGTCTGGCGCTGGCCCTTTGGCCCGCACCAG
CTGGCCGACCTGCCCGACGATGCCAAGGCCCACATCACCCGCATCAACCAGCTCGAGGGCATGGGCGCTGGCCCC
CAGCAATGGGCTGCCCGCCCCGTCGCCGGCATGATGGTCAGCCTGGACCACAGCATCTACTTCCACGAGCCCTTG
CGTGTCAGGGCCGACGAGTGGATGTTTGTCGAGATGGACAGTCCCTGGGCCGGCGACGGCCGCGGTGTGGTGATG
CAGCGCATCTTTGCAAAGGACGGCACGCTGCTGGCCACGTGTGTGCAAGAGGTGCCCATCCCAACGCCATTGTCT
CCATCGCCTTGACACTAACTGTGCTTGTTCTTGTCCAGGGCGTCATACGGCTCAAGCCCGACGGCACCGAGGCTA
GTTCCAAGCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail