Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2342
Gene name
LocationContig_183:13849..15087
Strand-
Gene length (bp)1238
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10288 CTU2 Cytoplasmic tRNA 2-thiolation protein 2 1.0E-09 310 369

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B2W6W8|CTU2_PYRTR Cytoplasmic tRNA 2-thiolation protein 2 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=ncs2 PE=3 SV=1 6 390 1.0E-49
sp|Q0UDH1|CTU2_PHANO Cytoplasmic tRNA 2-thiolation protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NCS2 PE=3 SV=1 5 390 8.0E-47
sp|A7F190|CTU2_SCLS1 Cytoplasmic tRNA 2-thiolation protein 2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ncs2 PE=3 SV=1 11 352 1.0E-43
sp|A1CBI6|CTU2_ASPCL Cytoplasmic tRNA 2-thiolation protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ncs2 PE=3 SV=1 8 389 5.0E-39
sp|Q2U667|CTU2_ASPOR Cytoplasmic tRNA 2-thiolation protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ncs2 PE=3 SV=1 8 389 7.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B2W6W8|CTU2_PYRTR Cytoplasmic tRNA 2-thiolation protein 2 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=ncs2 PE=3 SV=1 6 390 1.0E-49
sp|Q0UDH1|CTU2_PHANO Cytoplasmic tRNA 2-thiolation protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NCS2 PE=3 SV=1 5 390 8.0E-47
sp|A7F190|CTU2_SCLS1 Cytoplasmic tRNA 2-thiolation protein 2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ncs2 PE=3 SV=1 11 352 1.0E-43
sp|A1CBI6|CTU2_ASPCL Cytoplasmic tRNA 2-thiolation protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ncs2 PE=3 SV=1 8 389 5.0E-39
sp|Q2U667|CTU2_ASPOR Cytoplasmic tRNA 2-thiolation protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ncs2 PE=3 SV=1 8 389 7.0E-37
sp|A1DDV3|CTU2_NEOFI Cytoplasmic tRNA 2-thiolation protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ncs2 PE=3 SV=1 8 389 1.0E-32
sp|Q4WVK2|CTU2_ASPFU Cytoplasmic tRNA 2-thiolation protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ncs2 PE=3 SV=1 30 389 4.0E-31
sp|B0Y1E7|CTU2_ASPFC Cytoplasmic tRNA 2-thiolation protein 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=ncs2 PE=3 SV=1 30 389 4.0E-31
sp|A6QYX4|CTU2_AJECN Cytoplasmic tRNA 2-thiolation protein 2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=NCS2 PE=3 SV=1 61 389 1.0E-29
sp|A2R475|CTU2_ASPNC Cytoplasmic tRNA 2-thiolation protein 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ncs2 PE=3 SV=1 11 389 5.0E-26
sp|Q1DK31|CTU2_COCIM Cytoplasmic tRNA 2-thiolation protein 2 OS=Coccidioides immitis (strain RS) GN=NCS2 PE=3 SV=2 11 390 9.0E-26
sp|Q5BHB8|CTU2_EMENI Cytoplasmic tRNA 2-thiolation protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ncs2 PE=3 SV=2 50 392 2.0E-25
sp|A5DAK5|CTU2_PICGU Cytoplasmic tRNA 2-thiolation protein 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NCS2 PE=3 SV=2 3 390 4.0E-24
sp|Q6CF50|CTU2_YARLI Cytoplasmic tRNA 2-thiolation protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NCS2 PE=3 SV=1 6 365 6.0E-24
sp|Q6CIU0|CTU2_KLULA Cytoplasmic tRNA 2-thiolation protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NCS2 PE=3 SV=1 11 357 7.0E-21
sp|Q6BKN2|CTU2_DEBHA Cytoplasmic tRNA 2-thiolation protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NCS2 PE=3 SV=2 5 392 1.0E-20
sp|Q6FLE5|CTU2_CANGA Cytoplasmic tRNA 2-thiolation protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NCS2 PE=3 SV=1 7 341 5.0E-19
sp|A7TGI5|CTU2_VANPO Cytoplasmic tRNA 2-thiolation protein 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NCS2 PE=3 SV=1 1 374 8.0E-19
sp|A3M0F4|CTU2_PICST Cytoplasmic tRNA 2-thiolation protein 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NCS2 PE=3 SV=2 5 392 3.0E-18
sp|Q75BK0|CTU2_ASHGO Cytoplasmic tRNA 2-thiolation protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NCS2 PE=3 SV=1 10 341 7.0E-16
sp|Q59ZY9|CTU2_CANAL Cytoplasmic tRNA 2-thiolation protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCS2 PE=3 SV=1 6 392 7.0E-15
sp|Q9UUC7|CTU2_SCHPO Cytoplasmic tRNA 2-thiolation protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctu2 PE=1 SV=1 6 390 3.0E-14
sp|A6ZRW4|CTU2_YEAS7 Cytoplasmic tRNA 2-thiolation protein 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=NCS2 PE=3 SV=1 11 340 2.0E-13
sp|B3LNX6|CTU2_YEAS1 Cytoplasmic tRNA 2-thiolation protein 2 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=NCS2 PE=3 SV=1 11 340 5.0E-13
sp|P53923|CTU2_YEAST Cytoplasmic tRNA 2-thiolation protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCS2 PE=1 SV=1 11 340 1.0E-12
sp|B5VQS7|CTU2_YEAS6 Cytoplasmic tRNA 2-thiolation protein 2 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=NCS2 PE=3 SV=1 11 340 1.0E-12
sp|A5DSD3|CTU2_LODEL Cytoplasmic tRNA 2-thiolation protein 2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NCS2 PE=3 SV=1 11 392 9.0E-10
sp|Q6DC53|CTU2_DANRE Cytoplasmic tRNA 2-thiolation protein 2 OS=Danio rerio GN=ctu2 PE=2 SV=2 169 366 1.0E-08
sp|Q32NV1|CTU2B_XENLA Cytoplasmic tRNA 2-thiolation protein 2-B OS=Xenopus laevis GN=ctu2-b PE=2 SV=2 167 376 1.0E-06
sp|Q08B12|CTU2A_XENLA Cytoplasmic tRNA 2-thiolation protein 2-A OS=Xenopus laevis GN=ctu2-a PE=2 SV=1 167 376 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0034227 tRNA thio-modification Yes
GO:0002098 tRNA wobble uridine modification Yes
GO:0000049 tRNA binding Yes
GO:0008033 tRNA processing No
GO:0046483 heterocycle metabolic process No
GO:0034470 ncRNA processing No
GO:0034660 ncRNA metabolic process No
GO:0006396 RNA processing No
GO:0009451 RNA modification No
GO:0043412 macromolecule modification No
GO:0006400 tRNA modification No
GO:0006399 tRNA metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003723 RNA binding No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0002097 tRNA wobble base modification No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2342
MSETASASKPCKRCKAPDAPLRLRNDPTCRPCYVAFVESKAGRRLGALARDTRTSARPAPRRYLGGLSFGSSSTL
MTQVLDNSARFHSSQRSSPAFEAHLVHIDTRLSRHPNQHDSPAQRLLDAYRKRFTRVSFECVHLCKALTLDTIDW
SLFPSIAATGHVQNEMERLECIMDSLPSATSRADVTRLLTRHILLHMALQGSYAALILGHSTTALASMALSEVAN
GRGYSIPWQISDGIRIVSTSPKASDGTEATDKVANWAQIAIYYPLREVMRHEIMQYLELVPSLRELMPTDSAETS
NSIVSHKDLSIEQVMQRYFDSVEGSYSGIVANVVRTAGKLDTFAHDSSLCALCGMTLDEKGDSHWAGELGHSLEP
KRTPTVLCYGCKRSING*
Coding >OphauG2|2342
ATGTCTGAGACGGCCAGCGCCAGCAAGCCGTGCAAGCGTTGCAAGGCTCCCGATGCTCCTCTCCGCCTGCGAAAC
GACCCAACGTGTCGTCCATGCTATGTCGCCTTTGTCGAAAGCAAAGCAGGCCGCCGTCTGGGTGCCCTGGCAAGA
GACACGAGGACTTCGGCACGCCCTGCGCCGCGCAGATATCTTGGGGGCTTGTCCTTTGGATCGTCTTCTACTCTC
ATGACACAGGTGCTCGACAACAGCGCCCGGTTTCACTCGTCGCAGAGGTCGTCGCCTGCTTTTGAAGCACACCTT
GTTCACATCGACACCCGTCTTTCTCGCCACCCTAACCAACACGACTCACCTGCGCAAAGGCTCCTGGACGCGTAT
CGGAAGCGCTTCACTCGTGTCTCGTTTGAATGTGTACATCTTTGCAAGGCTTTGACGCTCGATACCATTGACTGG
TCTCTCTTTCCCTCGATTGCGGCTACAGGGCACGTTCAAAATGAAATGGAGCGTCTTGAATGCATCATGGACTCC
CTGCCGTCTGCAACTTCGAGGGCTGACGTCACGCGCCTGCTCACCCGCCACATACTGTTGCACATGGCCTTGCAA
GGATCTTATGCTGCTCTTATTCTGGGTCATAGCACAACAGCCTTGGCGTCCATGGCTTTATCCGAGGTTGCCAAC
GGTAGGGGCTATTCAATTCCATGGCAAATAAGTGATGGAATACGCATCGTCTCGACGTCTCCAAAAGCTTCAGAT
GGCACAGAAGCAACTGACAAGGTGGCAAATTGGGCCCAGATTGCCATTTATTACCCCTTGCGCGAAGTCATGAGG
CATGAAATCATGCAGTATCTGGAGTTGGTGCCATCACTACGCGAGCTCATGCCCACGGATAGCGCGGAAACCAGC
AATAGCATCGTCTCTCACAAGGACTTAAGCATTGAACAAGTCATGCAGAGGTATTTTGACAGCGTTGAAGGTTCA
TATTCGGGCATCGTGGCCAATGTTGTGCGAACAGCTGGCAAGTTGGACACATTTGCCCATGACAGCTCCCTTTGT
GCTTTGTGTGGTATGACTCTGGATGAGAAGGGAGACTCGCACTGGGCTGGGGAATTGGGCCATAGCTTAGAACCA
AAGCGTACTCCAACCGTCTTGTGTTACGGCTGTAAACGATCCATCAATGGCTAA
Transcript >OphauG2|2342
ATGTCTGAGACGGCCAGCGCCAGCAAGCCGTGCAAGCGTTGCAAGGCTCCCGATGCTCCTCTCCGCCTGCGAAAC
GACCCAACGTGTCGTCCATGCTATGTCGCCTTTGTCGAAAGCAAAGCAGGCCGCCGTCTGGGTGCCCTGGCAAGA
GACACGAGGACTTCGGCACGCCCTGCGCCGCGCAGATATCTTGGGGGCTTGTCCTTTGGATCGTCTTCTACTCTC
ATGACACAGGTGCTCGACAACAGCGCCCGGTTTCACTCGTCGCAGAGGTCGTCGCCTGCTTTTGAAGCACACCTT
GTTCACATCGACACCCGTCTTTCTCGCCACCCTAACCAACACGACTCACCTGCGCAAAGGCTCCTGGACGCGTAT
CGGAAGCGCTTCACTCGTGTCTCGTTTGAATGTGTACATCTTTGCAAGGCTTTGACGCTCGATACCATTGACTGG
TCTCTCTTTCCCTCGATTGCGGCTACAGGGCACGTTCAAAATGAAATGGAGCGTCTTGAATGCATCATGGACTCC
CTGCCGTCTGCAACTTCGAGGGCTGACGTCACGCGCCTGCTCACCCGCCACATACTGTTGCACATGGCCTTGCAA
GGATCTTATGCTGCTCTTATTCTGGGTCATAGCACAACAGCCTTGGCGTCCATGGCTTTATCCGAGGTTGCCAAC
GGTAGGGGCTATTCAATTCCATGGCAAATAAGTGATGGAATACGCATCGTCTCGACGTCTCCAAAAGCTTCAGAT
GGCACAGAAGCAACTGACAAGGTGGCAAATTGGGCCCAGATTGCCATTTATTACCCCTTGCGCGAAGTCATGAGG
CATGAAATCATGCAGTATCTGGAGTTGGTGCCATCACTACGCGAGCTCATGCCCACGGATAGCGCGGAAACCAGC
AATAGCATCGTCTCTCACAAGGACTTAAGCATTGAACAAGTCATGCAGAGGTATTTTGACAGCGTTGAAGGTTCA
TATTCGGGCATCGTGGCCAATGTTGTGCGAACAGCTGGCAAGTTGGACACATTTGCCCATGACAGCTCCCTTTGT
GCTTTGTGTGGTATGACTCTGGATGAGAAGGGAGACTCGCACTGGGCTGGGGAATTGGGCCATAGCTTAGAACCA
AAGCGTACTCCAACCGTCTTGTGTTACGGCTGTAAACGATCCATCAATGGCTAA
Gene >OphauG2|2342
ATGTCTGAGACGGCCAGCGCCAGCAAGCCGTGCAAGCGTTGCAAGGCTCCCGATGCTCCTCTCCGCCTGCGAAAC
GACCCAACGTGTCGGTGCGTCTCACAAATATAAATGGCGCCTGAGGGACGCGTGGCTGATTGGACAGTCGCAGTC
CATGCTATGTCGCCTTTGTCGAAAGCAAAGCAGGCCGCCGTCTGGGTGCCCTGGCAAGAGACACGAGGACTTCGG
CACGCCCTGCGCCGCGCAGATATCTTGGGGGCTTGTCCTTTGGATCGTCTTCTACTCTCATGACACAGGTGCTCG
ACAACAGCGCCCGGTTTCACTCGTCGCAGAGGTCGTCGCCTGCTTTTGAAGCACACCTTGTTCACATCGACACCC
GTCTTTCTCGCCACCCTAACCAACACGACTCACCTGCGCAAAGGCTCCTGGACGCGTATCGGAAGCGCTTCACTC
GTGTCTCGTTTGAATGTGTACATCTTTGCAAGGCTTTGACGCTCGATACCATTGACTGGTCTCTCTTTCCCTCGA
TTGCGGCTACAGGGCACGTTCAAAATGAAATGGAGCGTCTTGAATGCATCATGGACTCCCTGCCGTCTGCAACTT
CGAGGGCTGACGTCACGCGCCTGCTCACCCGCCACATACTGTTGCACATGGCCTTGCAAGGATCTTATGCTGCTC
TTATTCTGGGTCATAGCACAACAGCCTTGGCGTCCATGGCTTTATCCGAGGTTGCCAACGGTAGGGGCTATTCAA
TTCCATGGCAAATAAGTGATGGAATACGCATCGTCTCGACGTCTCCAAAAGCTTCAGATGGCACAGAAGCAACTG
ACAAGGTGGCAAATTGGGCCCAGATTGCCATTTATTACCCCTTGCGCGAAGTCATGAGGCATGAAATCATGCAGT
ATCTGGAGTTGGTGCCATCACTACGCGAGCTCATGCCCACGGATAGCGCGGAAACCAGCAATAGCATCGTCTCTC
ACAAGGACTTAAGCATTGAACAAGTCATGCAGAGGTATTTTGACAGCGTTGAAGGTTCATATTCGGGCATCGTGG
CCAATGTTGTGCGAACAGCTGGCAAGTTGGACACATTTGCCCATGACAGCTCCCTTTGTGCTTTGTGTGGTATGA
CTCTGGATGAGAAGGGAGACTCGCACTGGGCTGGGGAATTGGGCCATAGCTTAGAACCAAAGCGTACTCCAACCG
TCTTGTGTTACGGCTGTAAACGATCCATCAATGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail