Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2339
Gene name
LocationContig_183:9595..10124
Strand-
Gene length (bp)529
Transcript length (bp)366
Coding sequence length (bp)366
Protein length (aa) 122

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05486 SRP9-21 Signal recognition particle 9 kDa protein (SRP9) 1.3E-17 15 70

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5284
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2339 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|816
Ophiocordyceps camponoti-floridani Ophcf2|05662
Ophiocordyceps camponoti-rufipedis Ophun1|818
Ophiocordyceps kimflemingae Ophio5|6267
Ophiocordyceps subramaniannii Hirsu2|4704

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2339
MARSVPSSSRSPTIYSNNAESPAAVKPPRGSLVIKTYDPVSGVTLKYRTTKAAEVTRLVYSSLGRLGRSMAALPP
DVPDERTPDAHISETPGQGEAAAQAQPKTQQQQGGGGGKKKKKGRK*
Coding >OphauG2|2339
ATGGCTCGATCAGTCCCTTCTTCTTCTAGAAGCCCGACCATCTACTCCAACAATGCAGAGTCACCTGCAGCAGTG
AAGCCGCCTCGCGGCAGCCTCGTCATCAAGACGTACGATCCCGTCAGCGGCGTGACACTCAAATACCGGACCACA
AAGGCCGCCGAAGTGACGCGCCTCGTTTACTCGTCACTGGGCCGGCTAGGTCGGAGCATGGCTGCCTTGCCGCCC
GATGTGCCAGATGAACGCACCCCAGACGCGCATATTTCCGAAACGCCTGGCCAGGGTGAAGCAGCAGCTCAGGCG
CAGCCAAAAACACAACAGCAACAAGGAGGTGGAGGCGGCAAGAAAAAAAAGAAGGGTCGAAAGTGA
Transcript >OphauG2|2339
ATGGCTCGATCAGTCCCTTCTTCTTCTAGAAGCCCGACCATCTACTCCAACAATGCAGAGTCACCTGCAGCAGTG
AAGCCGCCTCGCGGCAGCCTCGTCATCAAGACGTACGATCCCGTCAGCGGCGTGACACTCAAATACCGGACCACA
AAGGCCGCCGAAGTGACGCGCCTCGTTTACTCGTCACTGGGCCGGCTAGGTCGGAGCATGGCTGCCTTGCCGCCC
GATGTGCCAGATGAACGCACCCCAGACGCGCATATTTCCGAAACGCCTGGCCAGGGTGAAGCAGCAGCTCAGGCG
CAGCCAAAAACACAACAGCAACAAGGAGGTGGAGGCGGCAAGAAAAAAAAGAAGGGTCGAAAGTGA
Gene >OphauG2|2339
ATGGCTCGATCAGTCCCTTCTTCTTCTAGAAGCCCGACCATCTACTGTACGTAGCTGTATCCAACGTGGAACTTG
CTCAGCTTCAGCCCTCCCATTCCCTTTTACAAACCAACAACTAACAGCACATGCCCTTGGACAATGGCAACCTGC
CTAGACACGCGTCACCACCAAGTATTCCATCAAGCCAACTAAACATTGCCCTCGCCCAGCCAACAATGCAGAGTC
ACCTGCAGCAGTGAAGCCGCCTCGCGGCAGCCTCGTCATCAAGACGTACGATCCCGTCAGCGGCGTGACACTCAA
ATACCGGACCACAAAGGCCGCCGAAGTGACGCGCCTCGTTTACTCGTCACTGGGCCGGCTAGGTCGGAGCATGGC
TGCCTTGCCGCCCGATGTGCCAGATGAACGCACCCCAGACGCGCATATTTCCGAAACGCCTGGCCAGGGTGAAGC
AGCAGCTCAGGCGCAGCCAAAAACACAACAGCAACAAGGAGGTGGAGGCGGCAAGAAAAAAAAGAAGGGTCGAAA
GTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail