Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|233
Gene name
LocationContig_1047:704..1759
Strand-
Gene length (bp)1055
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02144 Rad1 Repair protein Rad1/Rec1/Rad17 3.0E-70 6 284

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9QWZ1|RAD1_MOUSE Cell cycle checkpoint protein RAD1 OS=Mus musculus GN=Rad1 PE=1 SV=1 12 300 1.0E-28
sp|Q5R7X9|RAD1_PONAB Cell cycle checkpoint protein RAD1 OS=Pongo abelii GN=RAD1 PE=2 SV=1 12 300 1.0E-27
sp|O60671|RAD1_HUMAN Cell cycle checkpoint protein RAD1 OS=Homo sapiens GN=RAD1 PE=1 SV=1 12 300 1.0E-27
sp|P22193|RAD1_SCHPO DNA damage checkpoint control protein rad1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad1 PE=1 SV=2 5 300 1.0E-25

GO

GO Term Description Terminal node
GO:0000077 DNA damage checkpoint signaling Yes
GO:0006950 response to stress No
GO:0050794 regulation of cellular process No
GO:0033554 cellular response to stress No
GO:0048519 negative regulation of biological process No
GO:0000075 cell cycle checkpoint signaling No
GO:0007165 signal transduction No
GO:0042770 signal transduction in response to DNA damage No
GO:0050789 regulation of biological process No
GO:0051726 regulation of cell cycle No
GO:0035556 intracellular signal transduction No
GO:0008150 biological_process No
GO:1901987 regulation of cell cycle phase transition No
GO:0006974 cellular response to DNA damage stimulus No
GO:0031570 DNA integrity checkpoint signaling No
GO:0045786 negative regulation of cell cycle No
GO:1901988 negative regulation of cell cycle phase transition No
GO:0010948 negative regulation of cell cycle process No
GO:0009987 cellular process No
GO:0065007 biological regulation No
GO:0050896 response to stimulus No
GO:0048523 negative regulation of cellular process No
GO:0051716 cellular response to stimulus No
GO:0010564 regulation of cell cycle process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3373
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|233 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7899
Ophiocordyceps camponoti-floridani Ophcf2|02644
Ophiocordyceps camponoti-rufipedis Ophun1|4980
Ophiocordyceps kimflemingae Ophio5|1963
Ophiocordyceps subramaniannii Hirsu2|6302

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|233
MEPPLFRAVATSTRPLYQLVRCINFAPRVHVQITDDGIRLTADHARVMQGVAFLDKALFSAYTVNMRPAQDDEAP
ELPTFQISLVALLEVLQIFGAVDVATRAQKAEQDPYRSNLRNYRPDAFSNQALGISGTCTLLYAQEGDGFKVTIE
ESGVKTTAGLTTYLPEIPQEIPFDRNDLSFKMIMQSRCLLDCMSEISPMGPVKLSITATKSSPHLLLSSTSDHGT
SDVDFARARELLETFSVWRRWSQTFKFDFVKSASEAMRIASKVSLRGDGQGVLSLQFMVDMEDGKRSFLDFRFIP
YAPEDGDGDEQQEDLAMRQDEGWDMRELGAS*
Coding >OphauG2|233
ATGGAGCCTCCTCTGTTCCGAGCGGTTGCCACATCTACGCGTCCACTGTACCAACTCGTTCGCTGCATCAACTTT
GCGCCACGAGTCCACGTCCAGATAACCGACGATGGCATTCGACTGACGGCAGATCACGCACGGGTCATGCAAGGA
GTTGCATTCTTGGACAAGGCTCTCTTCTCGGCCTATACTGTCAATATGAGGCCGGCGCAAGACGACGAAGCACCC
GAGCTGCCCACTTTTCAGATTTCTCTGGTGGCTTTGCTCGAAGTGCTTCAGATATTTGGGGCTGTTGATGTGGCT
ACACGAGCGCAAAAGGCTGAGCAGGATCCATACCGAAGCAACTTGCGTAACTACCGCCCTGATGCATTCAGCAAC
CAGGCGCTTGGAATTTCGGGCACGTGCACCCTCTTGTATGCCCAGGAGGGCGATGGATTCAAGGTTACCATTGAG
GAGTCTGGCGTCAAGACGACGGCTGGTCTGACGACGTACCTGCCTGAAATCCCTCAAGAAATCCCCTTTGATCGC
AACGATTTGAGCTTCAAGATGATTATGCAATCTCGCTGCCTGCTGGACTGCATGTCGGAGATTTCGCCAATGGGC
CCTGTTAAGCTCAGCATTACTGCCACAAAGTCTAGTCCACATCTGCTTCTATCCAGCACTAGCGACCACGGCACA
TCTGACGTGGACTTTGCACGCGCTCGCGAACTGCTTGAGACGTTTAGCGTCTGGCGCCGCTGGTCACAGACATTC
AAGTTTGACTTTGTCAAGAGCGCAAGCGAGGCGATGCGTATTGCGTCAAAAGTTAGCCTTCGCGGCGACGGCCAG
GGCGTGCTCAGTTTACAGTTTATGGTGGACATGGAGGACGGGAAACGTAGTTTTCTTGACTTTCGCTTCATCCCA
TATGCTCCCGAGGACGGAGATGGGGATGAGCAGCAAGAGGACCTGGCCATGAGGCAAGATGAAGGTTGGGACATG
AGAGAGCTTGGTGCGTCTTAG
Transcript >OphauG2|233
ATGGAGCCTCCTCTGTTCCGAGCGGTTGCCACATCTACGCGTCCACTGTACCAACTCGTTCGCTGCATCAACTTT
GCGCCACGAGTCCACGTCCAGATAACCGACGATGGCATTCGACTGACGGCAGATCACGCACGGGTCATGCAAGGA
GTTGCATTCTTGGACAAGGCTCTCTTCTCGGCCTATACTGTCAATATGAGGCCGGCGCAAGACGACGAAGCACCC
GAGCTGCCCACTTTTCAGATTTCTCTGGTGGCTTTGCTCGAAGTGCTTCAGATATTTGGGGCTGTTGATGTGGCT
ACACGAGCGCAAAAGGCTGAGCAGGATCCATACCGAAGCAACTTGCGTAACTACCGCCCTGATGCATTCAGCAAC
CAGGCGCTTGGAATTTCGGGCACGTGCACCCTCTTGTATGCCCAGGAGGGCGATGGATTCAAGGTTACCATTGAG
GAGTCTGGCGTCAAGACGACGGCTGGTCTGACGACGTACCTGCCTGAAATCCCTCAAGAAATCCCCTTTGATCGC
AACGATTTGAGCTTCAAGATGATTATGCAATCTCGCTGCCTGCTGGACTGCATGTCGGAGATTTCGCCAATGGGC
CCTGTTAAGCTCAGCATTACTGCCACAAAGTCTAGTCCACATCTGCTTCTATCCAGCACTAGCGACCACGGCACA
TCTGACGTGGACTTTGCACGCGCTCGCGAACTGCTTGAGACGTTTAGCGTCTGGCGCCGCTGGTCACAGACATTC
AAGTTTGACTTTGTCAAGAGCGCAAGCGAGGCGATGCGTATTGCGTCAAAAGTTAGCCTTCGCGGCGACGGCCAG
GGCGTGCTCAGTTTACAGTTTATGGTGGACATGGAGGACGGGAAACGTAGTTTTCTTGACTTTCGCTTCATCCCA
TATGCTCCCGAGGACGGAGATGGGGATGAGCAGCAAGAGGACCTGGCCATGAGGCAAGATGAAGGTTGGGACATG
AGAGAGCTTGGTGCGTCTTAG
Gene >OphauG2|233
ATGGAGCCTCCTCTGTTCCGAGCGGTTGCCACATCTACGCGTCCACTGTACCAACTCGTTCGCTGCATCAACTTT
GCGCCACGAGTCCACGTCCAGATAACCGACGATGGCATTCGACTGACGGCAGATCACGCACGGGTCATGCAAGGT
ATATGTTGGCTTGTTGATGAGGTATTGTGGCCGGCTGCTAACTCTGCTTGGGTGTAGGAGTTGCATTCTTGGACA
AGGCTCTCTTCTCGGCCTATACTGTCAATATGAGGCCGGCGCAAGACGACGAAGCACCCGAGCTGCCCACTTTTC
AGATTTCTCTGGTGGCTTTGCTCGAAGTGCTTCAGATATTTGGGGCTGTTGATGTGGCTACACGAGCGCAAAAGG
CTGAGCAGGATCCATACCGAAGCAACTTGCGTAACTACCGCCCTGATGCATTCAGCAACCAGGCGCTTGGAATTT
CGGGCACGTGCACCCTCTTGTATGCCCAGGAGGGCGATGGATTCAAGGTTACCATTGAGGAGTCTGGCGTCAAGA
CGACGGCTGGTCTGACGACGTACCTGCCTGAAATCCCTCAAGAAATCCCCTTTGATCGCAACGATTTGAGCTTCA
AGATGATTATGCAATCTCGCTGCCTGCTGGACTGCATGTCGGAGATTTCGCCAATGGGCCCTGTTAAGCTCAGCA
TTACTGCCACAAAGTCTAGTCCACATCTGCTTCTATCCAGCACTAGCGACCACGGCACATCTGACGTGGACTTTG
CACGCGCTCGCGAACTGCTTGAGACGTTTAGCGTCTGGCGCCGCTGGTCACAGACATTCAAGTTTGACTTTGTCA
AGAGCGCAAGCGAGGCGATGCGTATTGCGTCAAAAGTTAGCCTTCGCGGCGACGGCCAGGGCGTGCTCAGTTTAC
AGTTTATGGTGGACATGGAGGACGGGAAACGTAGTTTTCTTGACTTTCGCTTCATCCCATATGCTCCCGAGGACG
GAGATGGGGATGAGCAGCAAGAGGACCTGGCCATGAGGCAAGATGAAGGTTGGGACATGAGAGAGCTTGGTGCGT
CTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail