Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2323
Gene name
LocationContig_182:18457..19454
Strand+
Gene length (bp)997
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01885 PTS_2-RNA RNA 2'-phosphotransferase, Tpt1 / KptA family 8.5E-65 36 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3ZBM7|TRPT1_BOVIN tRNA 2'-phosphotransferase 1 OS=Bos taurus GN=TRPT1 PE=2 SV=3 14 239 3.0E-41
sp|Q8K3A2|TRPT1_MOUSE tRNA 2'-phosphotransferase 1 OS=Mus musculus GN=Trpt1 PE=2 SV=2 24 244 1.0E-40
sp|Q86TN4|TRPT1_HUMAN tRNA 2'-phosphotransferase 1 OS=Homo sapiens GN=TRPT1 PE=1 SV=2 19 244 5.0E-40
sp|O14045|TPT1_SCHPO Putative tRNA 2'-phosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.12c PE=3 SV=2 38 240 1.0E-35
sp|Q5EAR5|TRPT1_DANRE tRNA 2'-phosphotransferase 1 OS=Danio rerio GN=trpt1 PE=2 SV=2 35 239 5.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3ZBM7|TRPT1_BOVIN tRNA 2'-phosphotransferase 1 OS=Bos taurus GN=TRPT1 PE=2 SV=3 14 239 3.0E-41
sp|Q8K3A2|TRPT1_MOUSE tRNA 2'-phosphotransferase 1 OS=Mus musculus GN=Trpt1 PE=2 SV=2 24 244 1.0E-40
sp|Q86TN4|TRPT1_HUMAN tRNA 2'-phosphotransferase 1 OS=Homo sapiens GN=TRPT1 PE=1 SV=2 19 244 5.0E-40
sp|O14045|TPT1_SCHPO Putative tRNA 2'-phosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.12c PE=3 SV=2 38 240 1.0E-35
sp|Q5EAR5|TRPT1_DANRE tRNA 2'-phosphotransferase 1 OS=Danio rerio GN=trpt1 PE=2 SV=2 35 239 5.0E-35
sp|Q12272|TPT1_YEAST tRNA 2'-phosphotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPT1 PE=1 SV=1 33 224 4.0E-27
sp|Q7NVB8|KPTA_CHRVO Probable RNA 2'-phosphotransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=kptA PE=3 SV=2 41 243 5.0E-25
sp|Q395F2|KPTA_BURL3 Probable RNA 2'-phosphotransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=kptA PE=3 SV=1 41 224 5.0E-21
sp|B1VP90|KPTA_STRGG Probable RNA 2'-phosphotransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=kptA PE=3 SV=1 36 232 7.0E-21
sp|B0C090|KPTA_ACAM1 Probable RNA 2'-phosphotransferase OS=Acaryochloris marina (strain MBIC 11017) GN=kptA PE=3 SV=1 40 224 1.0E-19
sp|Q9ZBX9|KPTA_STRCO Probable RNA 2'-phosphotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kptA PE=3 SV=1 36 225 1.0E-19
sp|Q4K4C7|KPTA_PSEF5 Probable RNA 2'-phosphotransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=kptA PE=3 SV=1 40 224 2.0E-19
sp|B5ZQT5|KPTA_RHILW Probable RNA 2'-phosphotransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=kptA PE=3 SV=1 37 233 6.0E-19
sp|Q1MG28|KPTA_RHIL3 Probable RNA 2'-phosphotransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=kptA PE=3 SV=1 37 233 7.0E-19
sp|Q02V26|KPTA_PSEAB Probable RNA 2'-phosphotransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=kptA PE=3 SV=1 40 225 5.0E-18
sp|B2IZ22|KPTA_NOSP7 Probable RNA 2'-phosphotransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=kptA PE=3 SV=1 35 224 5.0E-18
sp|Q2SQM5|KPTA_HAHCH Probable RNA 2'-phosphotransferase OS=Hahella chejuensis (strain KCTC 2396) GN=kptA PE=3 SV=1 47 233 7.0E-18
sp|Q9I778|KPTA_PSEAE Probable RNA 2'-phosphotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kptA PE=3 SV=1 40 225 1.0E-17
sp|Q3M450|KPTA_ANAVT Probable RNA 2'-phosphotransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=kptA PE=3 SV=1 35 224 2.0E-17
sp|A9B356|KPTA_HERA2 Probable RNA 2'-phosphotransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=kptA PE=3 SV=1 36 233 2.0E-16
sp|Q63WX9|KPTA_BURPS Probable RNA 2'-phosphotransferase OS=Burkholderia pseudomallei (strain K96243) GN=kptA PE=3 SV=1 41 224 2.0E-16
sp|Q0T8X6|KPTA_ECOL5 Probable RNA 2'-phosphotransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kptA PE=3 SV=1 39 224 3.0E-16
sp|Q7UEP2|KPTA_RHOBA Probable RNA 2'-phosphotransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=kptA PE=3 SV=1 38 224 3.0E-16
sp|A6UXB5|KPTA_PSEA7 Probable RNA 2'-phosphotransferase OS=Pseudomonas aeruginosa (strain PA7) GN=kptA PE=3 SV=1 40 224 4.0E-16
sp|Q0TUT1|KPTA_CLOP1 Probable RNA 2'-phosphotransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kptA PE=3 SV=1 39 223 6.0E-16
sp|A8A858|KPTA_ECOHS Probable RNA 2'-phosphotransferase OS=Escherichia coli O9:H4 (strain HS) GN=kptA PE=3 SV=1 40 224 7.0E-16
sp|B2TYV0|KPTA_SHIB3 Probable RNA 2'-phosphotransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kptA PE=3 SV=1 40 224 7.0E-16
sp|C4ZT19|KPTA_ECOBW Probable RNA 2'-phosphotransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kptA PE=3 SV=1 40 224 1.0E-15
sp|B9JFP7|KPTA_AGRRK Probable RNA 2'-phosphotransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=kptA PE=3 SV=1 37 233 1.0E-15
sp|B1LDT4|KPTA_ECOSM Probable RNA 2'-phosphotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kptA PE=3 SV=1 40 236 1.0E-15
sp|B6I2L3|KPTA_ECOSE Probable RNA 2'-phosphotransferase OS=Escherichia coli (strain SE11) GN=kptA PE=3 SV=1 40 224 1.0E-15
sp|B7LDY6|KPTA_ECO55 Probable RNA 2'-phosphotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=kptA PE=3 SV=1 40 224 1.0E-15
sp|B7NGY8|KPTA_ECOLU Probable RNA 2'-phosphotransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kptA PE=3 SV=1 40 224 2.0E-15
sp|P39380|KPTA_ECOLI RNA 2'-phosphotransferase OS=Escherichia coli (strain K12) GN=kptA PE=3 SV=2 40 224 2.0E-15
sp|A7ZVN0|KPTA_ECO24 Probable RNA 2'-phosphotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kptA PE=3 SV=1 40 224 2.0E-15
sp|B7LXP0|KPTA_ECO8A Probable RNA 2'-phosphotransferase OS=Escherichia coli O8 (strain IAI1) GN=kptA PE=3 SV=1 40 224 2.0E-15
sp|Q87VZ5|KPTA_PSESM Probable RNA 2'-phosphotransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=kptA PE=3 SV=1 39 226 3.0E-15
sp|Q8U9Z2|KPTA_AGRFC Probable RNA 2'-phosphotransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kptA PE=3 SV=1 40 235 4.0E-15
sp|B7MMM2|KPTA_ECO45 Probable RNA 2'-phosphotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kptA PE=3 SV=1 40 236 4.0E-15
sp|Q8R5N7|KPTA_FUSNN Probable RNA 2'-phosphotransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=kptA PE=3 SV=1 37 224 1.0E-14
sp|Q8XP22|KPTA_CLOPE Probable RNA 2'-phosphotransferase OS=Clostridium perfringens (strain 13 / Type A) GN=kptA PE=3 SV=1 39 223 4.0E-14
sp|Q48DQ3|KPTA_PSE14 Probable RNA 2'-phosphotransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=kptA PE=3 SV=1 39 234 7.0E-14
sp|Q0SWM0|KPTA_CLOPS Probable RNA 2'-phosphotransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=kptA PE=3 SV=1 39 223 1.0E-13
sp|A5FLZ4|KPTA_FLAJ1 Probable RNA 2'-phosphotransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=kptA PE=3 SV=1 41 224 6.0E-13
sp|C6DJM6|KPTA_PECCP Probable RNA 2'-phosphotransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=kptA PE=3 SV=1 40 224 3.0E-12
sp|A2BMI7|KPTA_HYPBU Probable RNA 2'-phosphotransferase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=kptA PE=3 SV=1 23 233 2.0E-11
sp|P57718|KPTA_THEAC Probable RNA 2'-phosphotransferase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kptA PE=3 SV=2 22 241 7.0E-11
sp|Q5JFX3|KPTA_THEKO Probable RNA 2'-phosphotransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=kptA PE=3 SV=1 39 235 7.0E-11
sp|Q5UXB8|KPTA_HALMA Probable RNA 2'-phosphotransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=kptA PE=3 SV=1 34 206 9.0E-11
sp|Q6DA62|KPTA_PECAS Probable RNA 2'-phosphotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=kptA PE=3 SV=1 36 224 4.0E-10
sp|B6YXF3|KPTA_THEON Probable RNA 2'-phosphotransferase OS=Thermococcus onnurineus (strain NA1) GN=kptA PE=3 SV=1 39 225 1.0E-09
sp|O28719|KPTA2_ARCFU Probable RNA 2'-phosphotransferase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=kptA2 PE=3 SV=1 39 216 3.0E-08
sp|O29841|KPTA1_ARCFU Probable RNA 2'-phosphotransferase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=kptA1 PE=3 SV=1 42 225 1.0E-07
sp|Q8U4K2|KPTA_PYRFU Probable RNA 2'-phosphotransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=kptA PE=3 SV=2 34 211 2.0E-07
sp|Q8ZSP2|KPTA_PYRAE Probable RNA 2'-phosphotransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=kptA PE=3 SV=1 34 210 2.0E-07
sp|Q8X261|KPTA_METKA Probable RNA 2'-phosphotransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=kptA PE=3 SV=1 21 227 2.0E-07
sp|Q97CA6|KPTA_THEVO Probable RNA 2'-phosphotransferase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=kptA PE=3 SV=1 22 235 9.0E-07
sp|O57899|KPTA_PYRHO Probable RNA 2'-phosphotransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=kptA PE=3 SV=1 38 206 1.0E-06
sp|Q6HH75|KPTA_BACHK Probable RNA 2'-phosphotransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kptA PE=3 SV=1 41 223 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016740 transferase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4848
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2323 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7922
Ophiocordyceps camponoti-floridani Ophcf2|06498
Ophiocordyceps kimflemingae Ophio5|5153
Ophiocordyceps subramaniannii Hirsu2|10908

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2323
MKADGSKSGNEGQSLGERRDEACGRQGGGRRGRGGREMQTSKALSKLLRHQAENAGIQLDGEGYASLDKVLSWPP
LKSLKVTVEEVQAIVATDDKQRFSLKANAGGSNSHSHGCEAAGFRIRANQGHSLKLDSSSLLEPVTLANVPACVL
HGTYFAFWGAIEAAGGLKPMGRNHIHCATGMPGGDGGVVSGMRHDAEVLVEIDAEASLRAGVEWWRSENGVLLTQ
GNQQGILSTAFFKKVTGRRVDIGVLWEDGVKRADLPQGIMATVPRGKGRRHERRHERRHERRHEGDDVSRSGQQQ
E*
Coding >OphauG2|2323
ATGAAGGCAGACGGGTCGAAAAGTGGCAATGAGGGCCAGAGCTTGGGAGAGAGGCGTGACGAAGCTTGTGGCAGG
CAGGGCGGAGGACGCAGAGGGCGCGGAGGGCGCGAGATGCAGACGTCCAAGGCCCTGTCGAAATTGCTGAGGCAC
CAGGCCGAGAATGCGGGGATCCAGCTCGACGGTGAGGGATACGCGTCGCTGGACAAAGTGCTCTCGTGGCCACCC
CTCAAGTCTCTCAAGGTGACAGTGGAAGAGGTGCAGGCCATTGTCGCGACAGACGACAAGCAACGCTTCTCGCTC
AAGGCCAACGCGGGCGGCAGCAACAGCCATAGCCATGGTTGTGAGGCTGCGGGATTCCGCATTCGTGCCAACCAA
GGCCACTCTCTCAAGCTGGACTCGTCGTCCTTGCTGGAGCCGGTAACGCTAGCAAATGTGCCGGCATGTGTGCTT
CATGGCACGTACTTTGCCTTTTGGGGCGCGATTGAGGCAGCGGGGGGGCTGAAGCCCATGGGGCGCAATCATATT
CACTGTGCGACGGGGATGCCCGGGGGTGACGGCGGGGTGGTGAGCGGGATGCGCCACGATGCTGAAGTGCTTGTT
GAGATTGATGCAGAGGCGAGCCTACGAGCAGGAGTGGAGTGGTGGCGCAGCGAGAATGGAGTGCTGCTTACGCAG
GGCAACCAACAGGGCATCTTGAGTACAGCGTTTTTCAAAAAGGTGACGGGGCGCAGGGTAGACATTGGCGTCTTG
TGGGAGGATGGGGTGAAGAGGGCAGACTTGCCGCAGGGCATCATGGCGACTGTGCCGCGTGGCAAGGGGAGGCGT
CATGAGAGGCGTCATGAGAGGCGTCACGAGAGGCGTCACGAGGGTGACGACGTGAGCAGAAGCGGGCAGCAACAA
GAATGA
Transcript >OphauG2|2323
ATGAAGGCAGACGGGTCGAAAAGTGGCAATGAGGGCCAGAGCTTGGGAGAGAGGCGTGACGAAGCTTGTGGCAGG
CAGGGCGGAGGACGCAGAGGGCGCGGAGGGCGCGAGATGCAGACGTCCAAGGCCCTGTCGAAATTGCTGAGGCAC
CAGGCCGAGAATGCGGGGATCCAGCTCGACGGTGAGGGATACGCGTCGCTGGACAAAGTGCTCTCGTGGCCACCC
CTCAAGTCTCTCAAGGTGACAGTGGAAGAGGTGCAGGCCATTGTCGCGACAGACGACAAGCAACGCTTCTCGCTC
AAGGCCAACGCGGGCGGCAGCAACAGCCATAGCCATGGTTGTGAGGCTGCGGGATTCCGCATTCGTGCCAACCAA
GGCCACTCTCTCAAGCTGGACTCGTCGTCCTTGCTGGAGCCGGTAACGCTAGCAAATGTGCCGGCATGTGTGCTT
CATGGCACGTACTTTGCCTTTTGGGGCGCGATTGAGGCAGCGGGGGGGCTGAAGCCCATGGGGCGCAATCATATT
CACTGTGCGACGGGGATGCCCGGGGGTGACGGCGGGGTGGTGAGCGGGATGCGCCACGATGCTGAAGTGCTTGTT
GAGATTGATGCAGAGGCGAGCCTACGAGCAGGAGTGGAGTGGTGGCGCAGCGAGAATGGAGTGCTGCTTACGCAG
GGCAACCAACAGGGCATCTTGAGTACAGCGTTTTTCAAAAAGGTGACGGGGCGCAGGGTAGACATTGGCGTCTTG
TGGGAGGATGGGGTGAAGAGGGCAGACTTGCCGCAGGGCATCATGGCGACTGTGCCGCGTGGCAAGGGGAGGCGT
CATGAGAGGCGTCATGAGAGGCGTCACGAGAGGCGTCACGAGGGTGACGACGTGAGCAGAAGCGGGCAGCAACAA
GAATGA
Gene >OphauG2|2323
ATGAAGGCAGACGGGTCGAAAAGTGGCAATGAGGGCCAGAGCTTGGGAGAGAGGCGTGACGAAGCTTGTGGCAGG
CAGGGCGGAGGACGCAGAGGGCGCGGAGGGCGCGAGATGCAGACGTCCAAGGCCCTGTCGAAATTGCTGAGGCAC
CAGGCCGAGAATGCGGGGATCCAGCTCGACGGTGAGGGATACGCGTCGCTGGACAAAGTGGTGGGTTAATCAAGC
GCTTTCCTGCTCTACTCTACTCTACGAGAATGAGCATGTCTGGCTGGAGCCATGGCTCACCAGCCTTGTGCAACA
GCTCTCGTGGCCACCCCTCAAGTCTCTCAAGGTGACAGTGGAAGAGGTGCAGGCCATTGTCGCGACAGACGACAA
GCAACGCTTCTCGCTCAAGGCCAACGCGGGCGGCAGCAACAGCCATAGCCATGGTTGTGAGGCTGCGGGATTCCG
CATTCGTGCCAACCAAGGCCACTCTCTCAAGCTGGACTCGTCGTCCTTGCTGGAGCCGGTAACGCTAGCAAATGT
GCCGGCATGTGTGCTTCATGGCACGTACTTTGCCTTTTGGGGCGCGATTGAGGCAGCGGGGGGGCTGAAGCCCAT
GGGGCGCAATCATATTCACTGTGCGACGGGGATGCCCGGGGGTGACGGCGGGGTGGTGAGCGGGATGCGCCACGA
TGCTGAAGTGCTTGTTGAGATTGATGCAGAGGCGAGCCTACGAGCAGGAGTGGAGTGGTGGCGCAGCGAGAATGG
AGTGCTGCTTACGCAGGGCAACCAACAGGGCATCTTGAGTACAGCGTTTTTCAAAAAGGTGACGGGGCGCAGGGT
AGACATTGGCGTCTTGTGGGAGGATGGGGTGAAGAGGGCAGACTTGCCGCAGGGCATCATGGCGACTGTGCCGCG
TGGCAAGGGGAGGCGTCATGAGAGGCGTCATGAGAGGCGTCACGAGAGGCGTCACGAGGGTGACGACGTGAGCAG
AAGCGGGCAGCAACAAGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail