Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2318
Gene name
LocationContig_182:2866..4087
Strand+
Gene length (bp)1221
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 2.4E-09 50 109
PF00013 KH_1 KH domain 1.3E-12 136 197
PF00013 KH_1 KH domain 7.5E-16 287 351

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74919|RNC1_SCHPO RNA-binding protein rnc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnc1 PE=1 SV=1 11 363 3.0E-105
sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 37 357 6.0E-39
sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=1 SV=3 17 357 7.0E-39
sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=1 SV=1 47 358 7.0E-37
sp|P57723|PCBP4_HUMAN Poly(rC)-binding protein 4 OS=Homo sapiens GN=PCBP4 PE=2 SV=1 39 358 7.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74919|RNC1_SCHPO RNA-binding protein rnc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnc1 PE=1 SV=1 11 363 3.0E-105
sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 37 357 6.0E-39
sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=1 SV=3 17 357 7.0E-39
sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=1 SV=1 47 358 7.0E-37
sp|P57723|PCBP4_HUMAN Poly(rC)-binding protein 4 OS=Homo sapiens GN=PCBP4 PE=2 SV=1 39 358 7.0E-37
sp|Q0VCU0|PCBP4_BOVIN Poly(rC)-binding protein 4 OS=Bos taurus GN=PCBP4 PE=2 SV=1 39 358 3.0E-36
sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 47 358 2.0E-32
sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 47 358 2.0E-32
sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 47 358 2.0E-32
sp|Q5E9A3|PCBP1_BOVIN Poly(rC)-binding protein 1 OS=Bos taurus GN=PCBP1 PE=2 SV=1 47 358 2.0E-32
sp|P38151|PBP2_YEAST PAB1-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBP2 PE=1 SV=1 49 364 2.0E-28
sp|A7TT46|HEK2_VANPO Heterogeneous nuclear rnp K-like protein 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=HEK2 PE=3 SV=1 50 366 7.0E-25
sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 47 222 5.0E-22
sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 47 222 1.0E-20
sp|Q6FUD8|HEK2_CANGA Heterogeneous nuclear rnp K-like protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEK2 PE=3 SV=1 50 363 9.0E-20
sp|C5E0I9|HEK2_ZYGRC Heterogeneous nuclear rnp K-like protein 2 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HEK2 PE=3 SV=1 50 361 2.0E-19
sp|Q756R8|HEK2_ASHGO Heterogeneous nuclear rnp K-like protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HEK2 PE=3 SV=1 56 216 4.0E-18
sp|P38199|HEK2_YEAST Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEK2 PE=1 SV=1 43 228 3.0E-16
sp|A6ZKR5|HEK2_YEAS7 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=HEK2 PE=3 SV=1 43 228 3.0E-16
sp|B3LNH0|HEK2_YEAS1 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HEK2 PE=3 SV=1 43 228 3.0E-16
sp|C8Z3W4|HEK2_YEAS8 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HEK2 PE=3 SV=1 43 228 3.0E-16
sp|C7GND0|HEK2_YEAS2 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain JAY291) GN=HEK2 PE=3 SV=1 43 228 3.0E-16
sp|C5DIR2|HEK2_LACTC Heterogeneous nuclear rnp K-like protein 2 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=HEK2 PE=3 SV=1 44 225 4.0E-16
sp|Q6CNI6|HEK2_KLULA Heterogeneous nuclear rnp K-like protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HEK2 PE=3 SV=1 47 204 2.0E-15
sp|Q9Y6M1|IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens GN=IGF2BP2 PE=1 SV=2 35 359 2.0E-13
sp|Q5RB68|IF2B2_PONAB Insulin-like growth factor 2 mRNA-binding protein 2 OS=Pongo abelii GN=IGF2BP2 PE=2 SV=1 35 359 6.0E-12
sp|O00425|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens GN=IGF2BP3 PE=1 SV=2 47 359 8.0E-12
sp|O57526|IF23B_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-B OS=Xenopus laevis GN=igf2bp3-b PE=1 SV=1 44 359 8.0E-12
sp|Q9UNW9|NOVA2_HUMAN RNA-binding protein Nova-2 OS=Homo sapiens GN=NOVA2 PE=1 SV=1 49 225 8.0E-12
sp|Q9LZ82|BTR1_ARATH Protein BTR1 OS=Arabidopsis thaliana GN=BTR1 PE=1 SV=1 33 360 2.0E-11
sp|O73932|IF23A_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-A OS=Xenopus laevis GN=igf2bp3-a PE=1 SV=1 44 359 3.0E-11
sp|Q5ZIQ3|HNRPK_CHICK Heterogeneous nuclear ribonucleoprotein K OS=Gallus gallus GN=HNRNPK PE=2 SV=1 34 203 4.0E-11
sp|Q2PFW9|NOVA1_MACFA RNA-binding protein Nova-1 OS=Macaca fascicularis GN=NOVA1 PE=2 SV=1 46 209 5.0E-11
sp|Q80WA4|NOVA1_RAT RNA-binding protein Nova-1 (Fragment) OS=Rattus norvegicus GN=Nova1 PE=2 SV=1 46 209 5.0E-11
sp|Q5SF07|IF2B2_MOUSE Insulin-like growth factor 2 mRNA-binding protein 2 OS=Mus musculus GN=Igf2bp2 PE=1 SV=1 36 359 9.0E-11
sp|Q9CPN8|IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Mus musculus GN=Igf2bp3 PE=1 SV=1 47 359 9.0E-11
sp|Q9PW80|IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio GN=igf2bp3 PE=1 SV=1 44 359 2.0E-10
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 59 356 3.0E-10
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 8 356 1.0E-09
sp|Q5ZLP8|IF2B3_CHICK Insulin-like growth factor 2 mRNA-binding protein 3 OS=Gallus gallus GN=IGF2BP3 PE=2 SV=1 29 359 1.0E-09
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 27 356 2.0E-09
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 27 356 2.0E-09
sp|Q9SR13|FLK_ARATH Flowering locus K homology domain OS=Arabidopsis thaliana GN=FLK PE=1 SV=1 49 357 3.0E-09
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 36 203 5.0E-09
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 36 203 6.0E-09
sp|Q9NZI8|IF2B1_HUMAN Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens GN=IGF2BP1 PE=1 SV=2 44 359 6.0E-09
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 9 203 7.0E-09
sp|Q6CNI6|HEK2_KLULA Heterogeneous nuclear rnp K-like protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HEK2 PE=3 SV=1 278 363 8.0E-09
sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 287 357 9.0E-09
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 53 193 1.0E-08
sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 287 357 1.0E-08
sp|Q8CGX0|IF2B1_RAT Insulin-like growth factor 2 mRNA-binding protein 1 OS=Rattus norvegicus GN=Igf2bp1 PE=1 SV=1 44 359 3.0E-08
sp|C5DIR2|HEK2_LACTC Heterogeneous nuclear rnp K-like protein 2 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=HEK2 PE=3 SV=1 287 361 5.0E-08
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 250 355 3.0E-07
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 226 355 4.0E-07
sp|Q756R8|HEK2_ASHGO Heterogeneous nuclear rnp K-like protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HEK2 PE=3 SV=1 278 365 5.0E-07
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 32 201 9.0E-07
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 32 201 3.0E-06
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 32 201 4.0E-06
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 250 355 6.0E-06
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 52 207 6.0E-06
sp|Q3T0D0|HNRPK_BOVIN Heterogeneous nuclear ribonucleoprotein K OS=Bos taurus GN=HNRNPK PE=2 SV=1 249 350 8.0E-06
sp|P61980|HNRPK_RAT Heterogeneous nuclear ribonucleoprotein K OS=Rattus norvegicus GN=Hnrnpk PE=1 SV=1 249 350 8.0E-06
sp|P61979|HNRPK_MOUSE Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus GN=Hnrnpk PE=1 SV=1 249 350 8.0E-06
sp|P61978|HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens GN=HNRNPK PE=1 SV=1 249 350 8.0E-06
sp|Q5R5H8|HNRPK_PONAB Heterogeneous nuclear ribonucleoprotein K OS=Pongo abelii GN=HNRNPK PE=2 SV=1 249 350 8.0E-06
sp|Q4R4M6|HNRPK_MACFA Heterogeneous nuclear ribonucleoprotein K OS=Macaca fascicularis GN=HNRNPK PE=2 SV=1 249 350 8.0E-06
sp|O19049|HNRPK_RABIT Heterogeneous nuclear ribonucleoprotein K OS=Oryctolagus cuniculus GN=HNRNPK PE=2 SV=1 249 350 8.0E-06
sp|Q5ZIQ3|HNRPK_CHICK Heterogeneous nuclear ribonucleoprotein K OS=Gallus gallus GN=HNRNPK PE=2 SV=1 249 350 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2318
MSASQEILSANGNDISDTMDQLKMDERLGPDGEPAPKTDEEYAQAQLTLRAIVSSKEAGVIIGKGGKNVADLRDE
TGVKAGVSKVVQGVHDRVLTITGECDAISRAYAIVARALLEGAPAMGMGGIVQNNGTHPIKLLISHNQMGTIIGR
QGLKIKHIQDVSGVRMVAQKEMLPQSTERIVEVQGTPEGIQRAVWEICKCLVDDWQRGTGTVLYNPVVRTQPGGT
GNTGGAGYNSGRGEYGGTRVMRTGNGADFSNGGSRPFNRRSDSDAATRGPPTHDENGEEIQTQNISIPADMVGCI
IGRAGSKISEIRKTSGARISIAKAPHDETGERMFTIMGTAKANESALFLLYENLEAEKMRRSQVQDQD*
Coding >OphauG2|2318
ATGTCCGCATCCCAAGAGATTCTGTCCGCCAACGGCAACGACATCAGCGATACCATGGATCAACTCAAGATGGAC
GAACGCCTCGGTCCCGACGGCGAACCCGCCCCTAAGACGGACGAAGAATATGCCCAGGCTCAACTTACGCTTCGG
GCCATCGTATCCTCAAAGGAAGCTGGCGTCATTATTGGAAAAGGGGGCAAGAATGTTGCTGATCTCAGAGATGAG
ACTGGCGTCAAGGCTGGCGTCAGCAAAGTCGTACAGGGCGTCCATGACCGTGTTTTGACCATAACGGGAGAATGT
GATGCCATCTCGAGGGCATATGCCATCGTCGCACGTGCGTTGCTCGAGGGCGCGCCTGCCATGGGTATGGGAGGA
ATCGTGCAAAACAACGGCACACATCCAATCAAGCTTCTCATTTCGCACAACCAGATGGGCACCATTATTGGCAGA
CAGGGCCTCAAGATCAAACACATTCAAGATGTGTCAGGGGTCCGCATGGTTGCGCAGAAGGAGATGCTGCCTCAG
TCGACGGAGCGCATTGTCGAGGTGCAAGGGACCCCAGAAGGTATCCAACGTGCCGTGTGGGAGATTTGCAAATGC
CTGGTCGATGACTGGCAGCGCGGCACAGGCACGGTGCTTTATAACCCTGTCGTTCGTACCCAGCCAGGCGGCACA
GGCAACACTGGCGGTGCTGGGTACAACTCGGGCAGGGGTGAGTATGGAGGCACGCGAGTGATGCGCACGGGTAAC
GGTGCCGACTTTAGCAATGGCGGCTCGCGGCCCTTCAACCGCCGTTCCGACTCGGATGCAGCCACTCGTGGTCCT
CCTACACATGATGAGAACGGAGAAGAAATTCAAACCCAAAACATCAGTATTCCAGCAGATATGGTTGGCTGCATA
ATTGGGCGCGCTGGCAGCAAGATTAGCGAAATCAGAAAGACATCGGGCGCCCGCATTTCAATCGCCAAGGCTCCT
CATGACGAGACGGGCGAGCGCATGTTTACCATAATGGGCACAGCCAAGGCGAACGAATCAGCCCTGTTTCTCTTG
TACGAGAATCTCGAGGCGGAAAAGATGCGGCGCAGCCAAGTCCAGGACCAAGACTAA
Transcript >OphauG2|2318
ATGTCCGCATCCCAAGAGATTCTGTCCGCCAACGGCAACGACATCAGCGATACCATGGATCAACTCAAGATGGAC
GAACGCCTCGGTCCCGACGGCGAACCCGCCCCTAAGACGGACGAAGAATATGCCCAGGCTCAACTTACGCTTCGG
GCCATCGTATCCTCAAAGGAAGCTGGCGTCATTATTGGAAAAGGGGGCAAGAATGTTGCTGATCTCAGAGATGAG
ACTGGCGTCAAGGCTGGCGTCAGCAAAGTCGTACAGGGCGTCCATGACCGTGTTTTGACCATAACGGGAGAATGT
GATGCCATCTCGAGGGCATATGCCATCGTCGCACGTGCGTTGCTCGAGGGCGCGCCTGCCATGGGTATGGGAGGA
ATCGTGCAAAACAACGGCACACATCCAATCAAGCTTCTCATTTCGCACAACCAGATGGGCACCATTATTGGCAGA
CAGGGCCTCAAGATCAAACACATTCAAGATGTGTCAGGGGTCCGCATGGTTGCGCAGAAGGAGATGCTGCCTCAG
TCGACGGAGCGCATTGTCGAGGTGCAAGGGACCCCAGAAGGTATCCAACGTGCCGTGTGGGAGATTTGCAAATGC
CTGGTCGATGACTGGCAGCGCGGCACAGGCACGGTGCTTTATAACCCTGTCGTTCGTACCCAGCCAGGCGGCACA
GGCAACACTGGCGGTGCTGGGTACAACTCGGGCAGGGGTGAGTATGGAGGCACGCGAGTGATGCGCACGGGTAAC
GGTGCCGACTTTAGCAATGGCGGCTCGCGGCCCTTCAACCGCCGTTCCGACTCGGATGCAGCCACTCGTGGTCCT
CCTACACATGATGAGAACGGAGAAGAAATTCAAACCCAAAACATCAGTATTCCAGCAGATATGGTTGGCTGCATA
ATTGGGCGCGCTGGCAGCAAGATTAGCGAAATCAGAAAGACATCGGGCGCCCGCATTTCAATCGCCAAGGCTCCT
CATGACGAGACGGGCGAGCGCATGTTTACCATAATGGGCACAGCCAAGGCGAACGAATCAGCCCTGTTTCTCTTG
TACGAGAATCTCGAGGCGGAAAAGATGCGGCGCAGCCAAGTCCAGGACCAAGACTAA
Gene >OphauG2|2318
ATGTCCGCATCCCAAGAGATTCTGTCCGCCAACGGCAACGACATCAGCGATACCATGGATCAACTCAAGATGGAC
GAACGCCTCGGTCCCGACGGCGAACCCGCCCCTAAGACGGACGAAGAATATGCCCAGGCTCAACTTACGCTTCGG
GCCATCGTATCCTCAAAGGAAGCTGGCGTCATTATTGGAAAAGGGGGCAAGAATGTTGCTGATCTCAGAGATGAG
ACTGGCGTCAAGGCTGGCGTCAGCAAAGTCGTACAGGGCGTCCATGACCGTGTTTTGACCATAACGGGAGAATGT
GATGCCATCTCGAGGGCATATGCCATCGTCGCACGTGCGTTGCTCGAGGGCGCGCCTGCCATGGGTATGGGAGGA
ATCGTGCAAAACAACGGCACACATCGTAGGCCTCCCACTCAATATGTCTGGCACATCAAGTTGCTCGTGTTGACT
CTTCTGTTGCAGCAATCAAGCTTCTCATTTCGCACAACCAGATGGGCACCATTATTGGCAGACAGGGCCTCAAGA
TCAAACACATTCAAGATGTGTCAGGGGTCCGCATGGTTGCGCAGAAGGAGATGCTGCCTCAGTCGACGGAGCGCA
TTGTCGAGGTGCAAGGGACCCCAGAAGGTATCCAACGTGCCGTGTGGGAGATTTGCAAATGCCTGGTCGATGACT
GGCAGCGCGGCACAGGCACGGTGCTTTATAACCCTGTCGTTCGTACCCAGCCAGGCGGCACAGGCAACACTGGCG
GTGCTGGGTACAACTCGGGCAGGGGTGAGTATGGAGGCACGCGAGTGATGCGCACGGGTAACGGTGCCGACTTTA
GCAATGGCGGCTCGCGGCCCTTCAACCGCCGTTCCGACTCGGATGCAGCCACTCGTGGTCCTCCTACACATGATG
AGAACGGAGAAGAAATTCAAACCCAAAACATCAGTATTCCAGCAGATATGGTTGGCTGCATAATTGGGCGCGCTG
GCAGCAAGATTAGCGAAATCAGAAAGACATCGGGCGCCCGCATTTCAATCGCCAAGGTGAGTTGAGACGTATGCT
GACGTTTGGGCCTGGTGCTGATGGAGGCTTTAGGCTCCTCATGACGAGACGGGCGAGCGCATGTTTACCATAATG
GGCACAGCCAAGGCGAACGAATCAGCCCTGTTTCTCTTGTACGAGAATCTCGAGGCGGAAAAGATGCGGCGCAGC
CAAGTCCAGGACCAAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail