Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2309
Gene name
LocationContig_181:24379..25570
Strand-
Gene length (bp)1191
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13324 GCIP Grap2 and cyclin-D-interacting 1.8E-13 48 345

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10368|YDBI_SCHPO Uncharacterized protein C22E12.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.18 PE=1 SV=1 1 218 7.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2309
MARSLHSLLQSALALLNDLKALLAAIVRDPSSTATATISASPFAAARDSAALIRAHSTKLALVLITSPWTPSAAA
SIVDALLDGPVPSLFTAVEACSSRHHTAFARKELAARSARVLDALQQQLLLVRRRFADAENLDQTGPDTATAILW
EACDNVGRLADMGIAGLMVQKTSHERDLLQDAWDELKSWGDEDSCADYQDHHDHDTSDTDTVDTDTSETDTPDTA
TIDNASPSSNPAPHPSSSSTTAQDLVDSLISQRPISPHDSHDIRPRLEVSLKRLRLVIILYQGALKRRLNTIPAV
LAPLDSQSSSLDLECPISRLDCLADVFHRLPQRFDDIAAALYNRDAPSAEETLATFCEDALFASQLLKYDWNNKR
DVFAEWLNQFNTEIMASFFPS*
Coding >OphauG2|2309
ATGGCCCGGAGCCTTCACTCGCTCCTCCAATCCGCCCTGGCCCTGCTCAACGACCTCAAGGCCCTCCTCGCCGCC
ATTGTGCGCGACCCGTCGTCCACGGCCACGGCCACAATATCCGCCAGTCCCTTTGCCGCCGCCCGCGACTCTGCC
GCCCTGATCCGCGCCCACTCCACCAAACTCGCCCTGGTCCTCATCACCTCGCCATGGACTCCTTCAGCCGCCGCC
TCCATTGTCGACGCCCTGCTCGACGGGCCCGTGCCCTCGCTCTTCACCGCTGTCGAGGCCTGCAGCTCTCGCCAC
CACACTGCCTTTGCCCGCAAGGAGCTTGCTGCCCGCTCCGCCCGCGTCCTCGATGCCCTGCAGCAGCAGTTGCTG
CTCGTTCGCCGCCGCTTTGCCGATGCTGAGAACCTGGACCAAACCGGCCCCGACACTGCTACTGCCATTCTGTGG
GAGGCCTGTGATAATGTTGGCCGCCTGGCTGACATGGGCATTGCTGGCCTCATGGTCCAAAAGACGTCTCACGAG
AGAGACTTGCTCCAGGATGCCTGGGACGAGCTGAAGAGCTGGGGTGATGAAGACTCGTGCGCCGATTACCAAGAC
CACCATGACCATGACACATCCGACACTGACACTGTCGACACTGACACCTCGGAAACCGACACCCCCGACACTGCC
ACTATCGACAATGCCAGCCCAAGCAGCAACCCCGCCCCCCACCCAAGCTCGTCGTCTACCACAGCACAAGACTTG
GTCGACAGCCTCATCTCTCAGCGGCCCATTTCGCCTCATGATTCTCATGACATTCGTCCCCGCCTTGAAGTCTCC
CTCAAGCGTTTGCGCCTCGTCATCATCCTCTATCAAGGCGCTCTCAAGCGCCGCCTCAACACGATACCTGCAGTC
CTCGCTCCCTTGGACTCTCAGTCCTCCTCATTAGACCTGGAATGCCCCATCTCCCGTCTCGATTGCCTGGCAGAC
GTTTTTCACCGACTGCCCCAACGCTTCGACGACATTGCCGCTGCTCTCTATAACCGCGACGCCCCCTCGGCCGAA
GAGACACTGGCCACCTTTTGTGAAGACGCCCTCTTTGCAAGTCAACTGCTCAAGTATGACTGGAACAACAAGCGC
GATGTCTTTGCCGAATGGCTCAATCAATTCAACACTGAGATAATGGCCAGCTTCTTTCCTTCCTGA
Transcript >OphauG2|2309
ATGGCCCGGAGCCTTCACTCGCTCCTCCAATCCGCCCTGGCCCTGCTCAACGACCTCAAGGCCCTCCTCGCCGCC
ATTGTGCGCGACCCGTCGTCCACGGCCACGGCCACAATATCCGCCAGTCCCTTTGCCGCCGCCCGCGACTCTGCC
GCCCTGATCCGCGCCCACTCCACCAAACTCGCCCTGGTCCTCATCACCTCGCCATGGACTCCTTCAGCCGCCGCC
TCCATTGTCGACGCCCTGCTCGACGGGCCCGTGCCCTCGCTCTTCACCGCTGTCGAGGCCTGCAGCTCTCGCCAC
CACACTGCCTTTGCCCGCAAGGAGCTTGCTGCCCGCTCCGCCCGCGTCCTCGATGCCCTGCAGCAGCAGTTGCTG
CTCGTTCGCCGCCGCTTTGCCGATGCTGAGAACCTGGACCAAACCGGCCCCGACACTGCTACTGCCATTCTGTGG
GAGGCCTGTGATAATGTTGGCCGCCTGGCTGACATGGGCATTGCTGGCCTCATGGTCCAAAAGACGTCTCACGAG
AGAGACTTGCTCCAGGATGCCTGGGACGAGCTGAAGAGCTGGGGTGATGAAGACTCGTGCGCCGATTACCAAGAC
CACCATGACCATGACACATCCGACACTGACACTGTCGACACTGACACCTCGGAAACCGACACCCCCGACACTGCC
ACTATCGACAATGCCAGCCCAAGCAGCAACCCCGCCCCCCACCCAAGCTCGTCGTCTACCACAGCACAAGACTTG
GTCGACAGCCTCATCTCTCAGCGGCCCATTTCGCCTCATGATTCTCATGACATTCGTCCCCGCCTTGAAGTCTCC
CTCAAGCGTTTGCGCCTCGTCATCATCCTCTATCAAGGCGCTCTCAAGCGCCGCCTCAACACGATACCTGCAGTC
CTCGCTCCCTTGGACTCTCAGTCCTCCTCATTAGACCTGGAATGCCCCATCTCCCGTCTCGATTGCCTGGCAGAC
GTTTTTCACCGACTGCCCCAACGCTTCGACGACATTGCCGCTGCTCTCTATAACCGCGACGCCCCCTCGGCCGAA
GAGACACTGGCCACCTTTTGTGAAGACGCCCTCTTTGCAAGTCAACTGCTCAAGTATGACTGGAACAACAAGCGC
GATGTCTTTGCCGAATGGCTCAATCAATTCAACACTGAGATAATGGCCAGCTTCTTTCCTTCCTGA
Gene >OphauG2|2309
ATGGCCCGGAGCCTTCACTCGCTCCTCCAATCCGCCCTGGCCCTGCTCAACGACCTCAAGGCCCTCCTCGCCGCC
ATTGTGCGCGACCCGTCGTCCACGGCCACGGCCACAATATCCGCCAGTCCCTTTGCCGCCGCCCGCGACTCTGCC
GCCCTGATCCGCGCCCACTCCACCAAACTCGCCCTGGTCCTCATCACCTCGCCATGGACTCCTTCAGCCGCCGCC
TCCATTGTCGACGCCCTGCTCGACGGGCCCGTGCCCTCGCTCTTCACCGCTGTCGAGGCCTGCAGCTCTCGCCAC
CACACTGCCTTTGCCCGCAAGGAGCTTGCTGCCCGCTCCGCCCGCGTCCTCGATGCCCTGCAGCAGCAGTTGCTG
CTCGTTCGCCGCCGCTTTGCCGATGCTGAGAACCTGGACCAAACCGGCCCCGACACTGCTACTGCCATTCTGTGG
GAGGCCTGTGATAATGTTGGCCGCCTGGCTGACATGGGCATTGCTGGCCTCATGGTCCAAAAGACGTCTCACGAG
AGAGACTTGCTCCAGGATGCCTGGGACGAGCTGAAGAGCTGGGGTGATGAAGACTCGTGCGCCGATTACCAAGAC
CACCATGACCATGACACATCCGACACTGACACTGTCGACACTGACACCTCGGAAACCGACACCCCCGACACTGCC
ACTATCGACAATGCCAGCCCAAGCAGCAACCCCGCCCCCCACCCAAGCTCGTCGTCTACCACAGCACAAGACTTG
GTCGACAGCCTCATCTCTCAGCGGCCCATTTCGCCTCATGATTCTCATGACATTCGTCCCCGCCTTGAAGTCTCC
CTCAAGCGTTTGCGCCTCGTCATCATCCTCTATCAAGGCGCTCTCAAGCGCCGCCTCAACACGATACCTGCAGTC
CTCGCTCCCTTGGACTCTCAGTCCTCCTCATTAGACCTGGAATGCCCCATCTCCCGTCTCGATTGCCTGGCAGAC
GTTTTTCACCGACTGCCCCAACGCTTCGACGACATTGCCGCTGCTCTCTATAACCGCGACGCCCCCTCGGCCGAA
GAGACACTGGCCACCTTTTGTGAAGACGCCCTCTTTGCAAGTCAACTGCTCAAGTATGACTGGAACAACAAGCGC
GATGTCTTTGCCGAATGGCTCAATCAATTCAACACTGAGATAATGGCCAGCTTCTTTCCTTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail