Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2309
Gene name
LocationContig_181:24379..25570
Strand-
Gene length (bp)1191
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13324 GCIP Grap2 and cyclin-D-interacting 1.8E-13 48 345

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10368|YDBI_SCHPO Uncharacterized protein C22E12.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.18 PE=1 SV=1 1 218 7.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4769
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2309 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4559
Ophiocordyceps camponoti-rufipedis Ophun1|988
Ophiocordyceps kimflemingae Ophio5|2124
Ophiocordyceps subramaniannii Hirsu2|10069

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2309
MARSLHSLLQSALALLNDLKALLAAIVRDPSSTATATISASPFAAARDSAALIRAHSTKLALVLITSPWTPSAAA
SIVDALLDGPVPSLFTAVEACSSRHHTAFARKELAARSARVLDALQQQLLLVRRRFADAENLDQTGPDTATAILW
EACDNVGRLADMGIAGLMVQKTSHERDLLQDAWDELKSWGDEDSCADYQDHHDHDTSDTDTVDTDTSETDTPDTA
TIDNASPSSNPAPHPSSSSTTAQDLVDSLISQRPISPHDSHDIRPRLEVSLKRLRLVIILYQGALKRRLNTIPAV
LAPLDSQSSSLDLECPISRLDCLADVFHRLPQRFDDIAAALYNRDAPSAEETLATFCEDALFASQLLKYDWNNKR
DVFAEWLNQFNTEIMASFFPS*
Coding >OphauG2|2309
ATGGCCCGGAGCCTTCACTCGCTCCTCCAATCCGCCCTGGCCCTGCTCAACGACCTCAAGGCCCTCCTCGCCGCC
ATTGTGCGCGACCCGTCGTCCACGGCCACGGCCACAATATCCGCCAGTCCCTTTGCCGCCGCCCGCGACTCTGCC
GCCCTGATCCGCGCCCACTCCACCAAACTCGCCCTGGTCCTCATCACCTCGCCATGGACTCCTTCAGCCGCCGCC
TCCATTGTCGACGCCCTGCTCGACGGGCCCGTGCCCTCGCTCTTCACCGCTGTCGAGGCCTGCAGCTCTCGCCAC
CACACTGCCTTTGCCCGCAAGGAGCTTGCTGCCCGCTCCGCCCGCGTCCTCGATGCCCTGCAGCAGCAGTTGCTG
CTCGTTCGCCGCCGCTTTGCCGATGCTGAGAACCTGGACCAAACCGGCCCCGACACTGCTACTGCCATTCTGTGG
GAGGCCTGTGATAATGTTGGCCGCCTGGCTGACATGGGCATTGCTGGCCTCATGGTCCAAAAGACGTCTCACGAG
AGAGACTTGCTCCAGGATGCCTGGGACGAGCTGAAGAGCTGGGGTGATGAAGACTCGTGCGCCGATTACCAAGAC
CACCATGACCATGACACATCCGACACTGACACTGTCGACACTGACACCTCGGAAACCGACACCCCCGACACTGCC
ACTATCGACAATGCCAGCCCAAGCAGCAACCCCGCCCCCCACCCAAGCTCGTCGTCTACCACAGCACAAGACTTG
GTCGACAGCCTCATCTCTCAGCGGCCCATTTCGCCTCATGATTCTCATGACATTCGTCCCCGCCTTGAAGTCTCC
CTCAAGCGTTTGCGCCTCGTCATCATCCTCTATCAAGGCGCTCTCAAGCGCCGCCTCAACACGATACCTGCAGTC
CTCGCTCCCTTGGACTCTCAGTCCTCCTCATTAGACCTGGAATGCCCCATCTCCCGTCTCGATTGCCTGGCAGAC
GTTTTTCACCGACTGCCCCAACGCTTCGACGACATTGCCGCTGCTCTCTATAACCGCGACGCCCCCTCGGCCGAA
GAGACACTGGCCACCTTTTGTGAAGACGCCCTCTTTGCAAGTCAACTGCTCAAGTATGACTGGAACAACAAGCGC
GATGTCTTTGCCGAATGGCTCAATCAATTCAACACTGAGATAATGGCCAGCTTCTTTCCTTCCTGA
Transcript >OphauG2|2309
ATGGCCCGGAGCCTTCACTCGCTCCTCCAATCCGCCCTGGCCCTGCTCAACGACCTCAAGGCCCTCCTCGCCGCC
ATTGTGCGCGACCCGTCGTCCACGGCCACGGCCACAATATCCGCCAGTCCCTTTGCCGCCGCCCGCGACTCTGCC
GCCCTGATCCGCGCCCACTCCACCAAACTCGCCCTGGTCCTCATCACCTCGCCATGGACTCCTTCAGCCGCCGCC
TCCATTGTCGACGCCCTGCTCGACGGGCCCGTGCCCTCGCTCTTCACCGCTGTCGAGGCCTGCAGCTCTCGCCAC
CACACTGCCTTTGCCCGCAAGGAGCTTGCTGCCCGCTCCGCCCGCGTCCTCGATGCCCTGCAGCAGCAGTTGCTG
CTCGTTCGCCGCCGCTTTGCCGATGCTGAGAACCTGGACCAAACCGGCCCCGACACTGCTACTGCCATTCTGTGG
GAGGCCTGTGATAATGTTGGCCGCCTGGCTGACATGGGCATTGCTGGCCTCATGGTCCAAAAGACGTCTCACGAG
AGAGACTTGCTCCAGGATGCCTGGGACGAGCTGAAGAGCTGGGGTGATGAAGACTCGTGCGCCGATTACCAAGAC
CACCATGACCATGACACATCCGACACTGACACTGTCGACACTGACACCTCGGAAACCGACACCCCCGACACTGCC
ACTATCGACAATGCCAGCCCAAGCAGCAACCCCGCCCCCCACCCAAGCTCGTCGTCTACCACAGCACAAGACTTG
GTCGACAGCCTCATCTCTCAGCGGCCCATTTCGCCTCATGATTCTCATGACATTCGTCCCCGCCTTGAAGTCTCC
CTCAAGCGTTTGCGCCTCGTCATCATCCTCTATCAAGGCGCTCTCAAGCGCCGCCTCAACACGATACCTGCAGTC
CTCGCTCCCTTGGACTCTCAGTCCTCCTCATTAGACCTGGAATGCCCCATCTCCCGTCTCGATTGCCTGGCAGAC
GTTTTTCACCGACTGCCCCAACGCTTCGACGACATTGCCGCTGCTCTCTATAACCGCGACGCCCCCTCGGCCGAA
GAGACACTGGCCACCTTTTGTGAAGACGCCCTCTTTGCAAGTCAACTGCTCAAGTATGACTGGAACAACAAGCGC
GATGTCTTTGCCGAATGGCTCAATCAATTCAACACTGAGATAATGGCCAGCTTCTTTCCTTCCTGA
Gene >OphauG2|2309
ATGGCCCGGAGCCTTCACTCGCTCCTCCAATCCGCCCTGGCCCTGCTCAACGACCTCAAGGCCCTCCTCGCCGCC
ATTGTGCGCGACCCGTCGTCCACGGCCACGGCCACAATATCCGCCAGTCCCTTTGCCGCCGCCCGCGACTCTGCC
GCCCTGATCCGCGCCCACTCCACCAAACTCGCCCTGGTCCTCATCACCTCGCCATGGACTCCTTCAGCCGCCGCC
TCCATTGTCGACGCCCTGCTCGACGGGCCCGTGCCCTCGCTCTTCACCGCTGTCGAGGCCTGCAGCTCTCGCCAC
CACACTGCCTTTGCCCGCAAGGAGCTTGCTGCCCGCTCCGCCCGCGTCCTCGATGCCCTGCAGCAGCAGTTGCTG
CTCGTTCGCCGCCGCTTTGCCGATGCTGAGAACCTGGACCAAACCGGCCCCGACACTGCTACTGCCATTCTGTGG
GAGGCCTGTGATAATGTTGGCCGCCTGGCTGACATGGGCATTGCTGGCCTCATGGTCCAAAAGACGTCTCACGAG
AGAGACTTGCTCCAGGATGCCTGGGACGAGCTGAAGAGCTGGGGTGATGAAGACTCGTGCGCCGATTACCAAGAC
CACCATGACCATGACACATCCGACACTGACACTGTCGACACTGACACCTCGGAAACCGACACCCCCGACACTGCC
ACTATCGACAATGCCAGCCCAAGCAGCAACCCCGCCCCCCACCCAAGCTCGTCGTCTACCACAGCACAAGACTTG
GTCGACAGCCTCATCTCTCAGCGGCCCATTTCGCCTCATGATTCTCATGACATTCGTCCCCGCCTTGAAGTCTCC
CTCAAGCGTTTGCGCCTCGTCATCATCCTCTATCAAGGCGCTCTCAAGCGCCGCCTCAACACGATACCTGCAGTC
CTCGCTCCCTTGGACTCTCAGTCCTCCTCATTAGACCTGGAATGCCCCATCTCCCGTCTCGATTGCCTGGCAGAC
GTTTTTCACCGACTGCCCCAACGCTTCGACGACATTGCCGCTGCTCTCTATAACCGCGACGCCCCCTCGGCCGAA
GAGACACTGGCCACCTTTTGTGAAGACGCCCTCTTTGCAAGTCAACTGCTCAAGTATGACTGGAACAACAAGCGC
GATGTCTTTGCCGAATGGCTCAATCAATTCAACACTGAGATAATGGCCAGCTTCTTTCCTTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail