Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|23
Gene name
LocationContig_1:63232..64852
Strand-
Gene length (bp)1620
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13094 CENP-Q CENP-Q, a CENPA-CAD centromere complex subunit 2.1E-45 257 441

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5338
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|23 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2684
Ophiocordyceps camponoti-floridani Ophcf2|05771
Ophiocordyceps camponoti-rufipedis Ophun1|6013
Ophiocordyceps subramaniannii Hirsu2|5098

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|23
MASESRASKRKRHEPPQPDAQQPDAPLQAAAASSRPRKRPTKVASDQSQRPQQLAPPRTVKQRAATRQDAQNKAS
PHGRKETRHDARLHSPTPTTRRRPARQTPQNQAAQNAKLPPARHSKRCRDQSDEQTDKQSTKRRRKPLHAKLPSS
IGRRGIPQPSAAPRLQTAHGHQAAEHHAAGDQAAPRSPPRPFPHLAPRIHRLRHSTIEAKWSPLTTPSLDAVSSM
LHLAHRPILQRISNTHQRSHLALAALRLVTHRISRKISRGLPFPPASMPASAVPNPQAQTASRHDSDGGRRAELN
LETVLDAEAALEAQLQPAAHAVEALRREKEHMQIQLEKDYQALQTLEADARAHARGQRDLLTKAHPLVSVAKRPE
KRPHDAGTVASKTSCGGLFTEILDSNDKDLNPLALQLSQHVESLSANLRPVDGVVPQLARSRAALQAVLLRHLSP
DQYERVLLAQ*
Coding >OphauG2|23
ATGGCATCCGAGTCGCGCGCCTCCAAGCGCAAACGCCATGAGCCGCCTCAGCCCGACGCCCAGCAGCCCGACGCG
CCGCTCCAAGCCGCCGCCGCCTCATCAAGGCCCCGAAAGCGTCCTACAAAAGTAGCCAGCGACCAGAGCCAACGG
CCCCAGCAGCTAGCTCCGCCAAGGACTGTAAAGCAACGCGCCGCCACTAGACAAGACGCGCAGAACAAGGCGTCG
CCACATGGGCGCAAAGAGACGCGACACGACGCCCGTCTGCACAGCCCTACGCCTACAACCCGGCGTCGGCCTGCG
AGACAAACGCCTCAAAACCAAGCCGCCCAAAATGCAAAGCTTCCACCAGCACGCCATTCGAAACGATGCCGGGAC
CAGAGCGACGAGCAGACAGACAAGCAGTCAACAAAGCGCCGTCGCAAACCCCTGCATGCCAAACTCCCGTCGTCG
ATTGGACGACGCGGCATTCCACAGCCGTCTGCTGCGCCGCGTCTCCAGACGGCCCATGGGCATCAAGCTGCCGAG
CATCACGCTGCCGGCGACCAAGCTGCTCCTAGGTCGCCTCCGCGCCCATTCCCCCATCTCGCCCCTCGCATCCAT
CGCCTTCGCCATTCCACCATTGAGGCAAAATGGTCTCCTCTCACAACCCCCTCGCTCGACGCCGTATCCTCCATG
CTACACCTTGCTCATCGCCCTATTCTCCAGCGCATCTCCAACACGCACCAGCGCAGTCACCTTGCCTTGGCCGCC
CTTCGCCTCGTCACGCACCGTATCTCGCGCAAAATCTCGCGTGGGTTGCCCTTCCCACCGGCATCCATGCCAGCC
TCGGCCGTTCCCAACCCCCAGGCGCAGACGGCTAGCCGACACGACTCTGATGGCGGCCGTCGGGCAGAGCTGAAT
CTTGAGACTGTTCTCGATGCAGAGGCCGCTTTGGAGGCCCAGCTACAGCCGGCAGCGCACGCCGTCGAGGCTCTT
CGCAGGGAGAAGGAACACATGCAAATCCAACTTGAAAAGGATTACCAAGCGCTGCAGACGCTCGAGGCTGATGCC
CGCGCACACGCCCGAGGCCAGCGTGATTTGCTCACCAAGGCCCATCCCCTAGTTTCCGTTGCCAAGAGGCCAGAA
AAGAGGCCTCATGATGCTGGAACTGTTGCTTCCAAGACGTCTTGTGGAGGCCTCTTTACCGAAATACTTGATTCG
AATGACAAGGACCTCAATCCGCTAGCCCTCCAGCTCAGCCAACATGTCGAAAGCCTAAGCGCCAACCTGCGCCCG
GTCGATGGCGTCGTCCCACAGCTTGCGCGAAGTCGCGCCGCTCTGCAGGCCGTGCTACTGCGACACCTGAGTCCA
GACCAATACGAGCGCGTCTTGCTGGCTCAATAG
Transcript >OphauG2|23
ATGGCATCCGAGTCGCGCGCCTCCAAGCGCAAACGCCATGAGCCGCCTCAGCCCGACGCCCAGCAGCCCGACGCG
CCGCTCCAAGCCGCCGCCGCCTCATCAAGGCCCCGAAAGCGTCCTACAAAAGTAGCCAGCGACCAGAGCCAACGG
CCCCAGCAGCTAGCTCCGCCAAGGACTGTAAAGCAACGCGCCGCCACTAGACAAGACGCGCAGAACAAGGCGTCG
CCACATGGGCGCAAAGAGACGCGACACGACGCCCGTCTGCACAGCCCTACGCCTACAACCCGGCGTCGGCCTGCG
AGACAAACGCCTCAAAACCAAGCCGCCCAAAATGCAAAGCTTCCACCAGCACGCCATTCGAAACGATGCCGGGAC
CAGAGCGACGAGCAGACAGACAAGCAGTCAACAAAGCGCCGTCGCAAACCCCTGCATGCCAAACTCCCGTCGTCG
ATTGGACGACGCGGCATTCCACAGCCGTCTGCTGCGCCGCGTCTCCAGACGGCCCATGGGCATCAAGCTGCCGAG
CATCACGCTGCCGGCGACCAAGCTGCTCCTAGGTCGCCTCCGCGCCCATTCCCCCATCTCGCCCCTCGCATCCAT
CGCCTTCGCCATTCCACCATTGAGGCAAAATGGTCTCCTCTCACAACCCCCTCGCTCGACGCCGTATCCTCCATG
CTACACCTTGCTCATCGCCCTATTCTCCAGCGCATCTCCAACACGCACCAGCGCAGTCACCTTGCCTTGGCCGCC
CTTCGCCTCGTCACGCACCGTATCTCGCGCAAAATCTCGCGTGGGTTGCCCTTCCCACCGGCATCCATGCCAGCC
TCGGCCGTTCCCAACCCCCAGGCGCAGACGGCTAGCCGACACGACTCTGATGGCGGCCGTCGGGCAGAGCTGAAT
CTTGAGACTGTTCTCGATGCAGAGGCCGCTTTGGAGGCCCAGCTACAGCCGGCAGCGCACGCCGTCGAGGCTCTT
CGCAGGGAGAAGGAACACATGCAAATCCAACTTGAAAAGGATTACCAAGCGCTGCAGACGCTCGAGGCTGATGCC
CGCGCACACGCCCGAGGCCAGCGTGATTTGCTCACCAAGGCCCATCCCCTAGTTTCCGTTGCCAAGAGGCCAGAA
AAGAGGCCTCATGATGCTGGAACTGTTGCTTCCAAGACGTCTTGTGGAGGCCTCTTTACCGAAATACTTGATTCG
AATGACAAGGACCTCAATCCGCTAGCCCTCCAGCTCAGCCAACATGTCGAAAGCCTAAGCGCCAACCTGCGCCCG
GTCGATGGCGTCGTCCCACAGCTTGCGCGAAGTCGCGCCGCTCTGCAGGCCGTGCTACTGCGACACCTGAGTCCA
GACCAATACGAGCGCGTCTTGCTGGCTCAATAG
Gene >OphauG2|23
ATGGTGCGTCTCGCCACATTTGCCTGTGCCCATGCTTTGCTAATGCTCCCTGCCAGGCATCCGAGTCGCGCGCCT
CCAAGCGCAAACGCCATGAGCCGCCTCAGCCCGACGCCCAGCAGCCCGACGCGCCGCTCCAAGCCGCCGCCGCCT
CATCAAGGCCCCGAAAGCGTCCTACAAAAGTAGCCAGCGACCAGAGCCAACGGCCCCAGCAGCTAGCTCCGCCAA
GGACTGTAAAGCAACGCGCCGCCACTAGACAAGACGCGCAGAACAAGGCGTCGCCACATGGGCGCAAAGAGACGC
GACACGACGCCCGTCTGCACAGCCCTACGCCTACAACCCGGCGTCGGCCTGCGAGACAAACGCCTCAAAACCAAG
CCGCCCAAAATGCAAAGCTTCCACCAGCACGCCATTCGAAACGATGCCGGGACCAGAGCGACGAGCAGACAGACA
AGCAGTCAACAAAGCGCCGTCGCAAACCCCTGCATGCCAAACTCCCGTCGTCGATTGGACGACGCGGCATTCCAC
AGCCGTCTGCTGCGCCGCGTCTCCAGACGGCCCATGGGCATCAAGCTGCCGAGCATCACGCTGCCGGCGACCAAG
CTGCTCCTAGGTCGCCTCCGCGCCCATTCCCCCATCTCGCCCCTCGCATCCATCGCCTTCGCCATTCCACCATTG
AGGCAAAATGGTCTCCTCTCACAACCCCCTCGCTCGACGCCGTATCCTCCATGCTACACCTTGCTCATCGCCCTA
TTCTCCAGCGCATCTCCAACACGCACCAGCGCAGTCACCTTGCCTTGGCCGCCCTTCGCCTCGTCACGCACCGTA
TCTCGCGCAAAATCTCGCGTGGGTTGCCCTTCCCACCGGCATCCATGCCAGCCTCGGCCGTTCCCAACCCCCAGG
CGCAGACGGCTAGCCGACACGACTCTGATGGCGGCCGTCGGGCAGAGCTGAATCTTGAGACTGTTCTCGATGCAG
AGGCCGCTTTGGAGGCCCAGCTACAGCCGGCAGCGCACGCCGTCGAGGCTCTTCGCAGGGAGAAGGAACACATGC
AAATCCAACTTGAAAAGGATTACCAAGCGCTGCAGACGCTCGAGGCTGATGCCCGCGCACACGCCCGAGGCCAGC
GTGATTTGCTCACCAAGGCCCATCCCCTAGTTTCCGTTGCCAAGAGGCCAGAAAAGAGGCCTCATGATGCTGGAA
CTGTTGCTTCCAAGACGTCTTGTGGAGGCCTCTTTACCGTGAGTTTCTTGTCATGCTTTTCTTTTTCGTGGCCTC
TAGTGGCTATTTTCATTACCCCGAGGCTATTGCCGTTCCCTTGACATTGATATCATGACGGCTTGGTTCTTGACG
CATCATTGCTTGTCATGTGTCCAAACCCCCTAAAGCTCGCAGTGTTATATTAACCAAACAAAAACTGCATAGGAA
ATACTTGATTCGAATGACAAGGACCTCAATCCGCTAGCCCTCCAGCTCAGCCAACATGTCGAAAGCCTAAGCGCC
AACCTGCGCCCGGTCGATGGCGTCGTCCCACAGCTTGCGCGAAGTCGCGCCGCTCTGCAGGCCGTGCTACTGCGA
CACCTGAGTCCAGACCAATACGAGCGCGTCTTGCTGGCTCAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail