Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2290
Gene name
LocationContig_180:11460..13027
Strand+
Gene length (bp)1567
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 5.6E-12 199 375
PF00675 Peptidase_M16 Insulinase (Peptidase family M16) 6.9E-10 48 181

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60044|QCR2_NEUCR Cytochrome b-c1 complex subunit 2, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-2 PE=2 SV=2 1 457 7.0E-164
sp|P78761|QCR2_SCHPO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr2 PE=2 SV=2 43 453 2.0E-62
sp|Q6C2E3|QCR2_YARLI Cytochrome b-c1 complex subunit 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR2 PE=3 SV=1 32 453 7.0E-56
sp|P83782|QCR2_CANAL Cytochrome b-c1 complex subunit 2, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QCR2 PE=1 SV=2 46 353 3.0E-34
sp|Q6BPY6|QCR2_DEBHA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=QCR2 PE=3 SV=1 46 453 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60044|QCR2_NEUCR Cytochrome b-c1 complex subunit 2, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-2 PE=2 SV=2 1 457 7.0E-164
sp|P78761|QCR2_SCHPO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr2 PE=2 SV=2 43 453 2.0E-62
sp|Q6C2E3|QCR2_YARLI Cytochrome b-c1 complex subunit 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR2 PE=3 SV=1 32 453 7.0E-56
sp|P83782|QCR2_CANAL Cytochrome b-c1 complex subunit 2, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QCR2 PE=1 SV=2 46 353 3.0E-34
sp|Q6BPY6|QCR2_DEBHA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=QCR2 PE=3 SV=1 46 453 1.0E-30
sp|Q75CW5|QCR2_ASHGO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=QCR2 PE=3 SV=2 46 278 1.0E-27
sp|Q6CWJ6|QCR2_KLULA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR2 PE=3 SV=1 48 453 2.0E-25
sp|P07257|QCR2_YEAST Cytochrome b-c1 complex subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR2 PE=1 SV=1 43 375 9.0E-25
sp|P22695|QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens GN=UQCRC2 PE=1 SV=3 44 453 7.0E-19
sp|O04308|MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2 OS=Arabidopsis thaliana GN=MPPA2 PE=1 SV=1 44 456 5.0E-18
sp|Q6FSJ3|QCR2_CANGA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=QCR2 PE=3 SV=1 48 278 8.0E-18
sp|Q3SZ71|MPPB_BOVIN Mitochondrial-processing peptidase subunit beta OS=Bos taurus GN=PMPCB PE=2 SV=1 44 453 1.0E-17
sp|Q9DB77|QCR2_MOUSE Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus GN=Uqcrc2 PE=1 SV=1 44 453 2.0E-17
sp|P32551|QCR2_RAT Cytochrome b-c1 complex subunit 2, mitochondrial OS=Rattus norvegicus GN=Uqcrc2 PE=1 SV=2 44 453 5.0E-17
sp|P23004|QCR2_BOVIN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Bos taurus GN=UQCRC2 PE=1 SV=2 44 453 6.0E-17
sp|O75439|MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens GN=PMPCB PE=1 SV=2 44 448 3.0E-16
sp|Q9ZU25|MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1 OS=Arabidopsis thaliana GN=At1g51980 PE=2 SV=1 44 453 3.0E-16
sp|Q5REK3|MPPB_PONAB Mitochondrial-processing peptidase subunit beta OS=Pongo abelii GN=PMPCB PE=2 SV=1 44 448 6.0E-16
sp|Q9CXT8|MPPB_MOUSE Mitochondrial-processing peptidase subunit beta OS=Mus musculus GN=Pmpcb PE=1 SV=1 44 453 9.0E-16
sp|Q54F93|MPPA2_DICDI Mitochondrial-processing peptidase subunit alpha-2 OS=Dictyostelium discoideum GN=mppA2 PE=1 SV=1 44 453 7.0E-15
sp|Q03346|MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus GN=Pmpcb PE=1 SV=3 44 399 1.0E-14
sp|P29677|MPPA_SOLTU Mitochondrial-processing peptidase subunit alpha OS=Solanum tuberosum GN=MPP PE=1 SV=1 44 456 9.0E-14
sp|Q42290|MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta OS=Arabidopsis thaliana GN=At3g02090 PE=2 SV=2 44 448 1.0E-12
sp|O86835|Y5738_STRCO Uncharacterized zinc protease SCO5738 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5738 PE=3 SV=1 80 444 6.0E-12
sp|Q68FY0|QCR1_RAT Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus GN=Uqcrc1 PE=1 SV=1 44 336 7.0E-12
sp|Q9CZ13|QCR1_MOUSE Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus GN=Uqcrc1 PE=1 SV=2 44 336 1.0E-11
sp|Q86A84|MPPA1_DICDI Mitochondrial-processing peptidase subunit alpha-1 OS=Dictyostelium discoideum GN=mppA1 PE=1 SV=1 44 241 1.0E-10
sp|P43264|QCR1_EUGGR Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial OS=Euglena gracilis PE=2 SV=1 44 314 1.0E-10
sp|P11914|MPPA_YEAST Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS2 PE=1 SV=1 26 443 2.0E-10
sp|P23955|MPPA_NEUCR Mitochondrial-processing peptidase subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpp PE=1 SV=2 44 248 9.0E-10
sp|P31800|QCR1_BOVIN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Bos taurus GN=UQCRC1 PE=1 SV=2 44 336 2.0E-09
sp|Q9Y8B5|MPPB_LENED Mitochondrial-processing peptidase subunit beta OS=Lentinula edodes GN=mppB PE=3 SV=1 27 435 3.0E-09
sp|Q1RJ61|Y522_RICBR Uncharacterized zinc protease RBE_0522 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0522 PE=3 SV=1 60 374 7.0E-09
sp|P31930|QCR1_HUMAN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens GN=UQCRC1 PE=1 SV=3 44 229 1.0E-08
sp|P10507|MPPB_YEAST Mitochondrial-processing peptidase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS1 PE=1 SV=1 80 448 8.0E-08
sp|P11913|MPPB_NEUCR Mitochondrial-processing peptidase subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep PE=1 SV=1 1 444 1.0E-07
sp|Q68XF0|Y210_RICTY Uncharacterized zinc protease RT0210 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0210 PE=3 SV=1 60 390 2.0E-07
sp|Q4UML9|Y338_RICFE Uncharacterized zinc protease RF_0338 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0338 PE=3 SV=1 60 374 3.0E-07
sp|O05945|Y219_RICPR Uncharacterized zinc protease RP219 OS=Rickettsia prowazekii (strain Madrid E) GN=RP219 PE=3 SV=1 60 390 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2636
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2290 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7499
Ophiocordyceps camponoti-floridani Ophcf2|06579
Ophiocordyceps camponoti-rufipedis Ophun1|3226
Ophiocordyceps kimflemingae Ophio5|2985
Ophiocordyceps subramaniannii Hirsu2|4039

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2290
MLSRFALARNLHQVVRRSCSVHALQHRGFAAAASASAFDVSDVSGIKVASRDSHGPTTRLAVVSKAGTRYQPFPG
LCVGLEEFAFKKTRRRTALRITRESELLGAQLAASHTREALLIEASFLRQDLPYFAELLAEVISMTNYTTYEFHE
DVERVLDLKQAALNYDVPGLALDTAHAVAFHTGLGAPVYPMGSTPVKKYLNEEYIASYADVVYSKPNIAVVADGA
SVEHMAKWVGHFFSDVSASPRSGQTLKTEPSKYYGGEQRLNHAAGNSMVIAFPGSDINGSKPEMVVLAALLGGKS
TIKWSPGFSLLSKAASETRGLSATSRNLGYSDAGLVVVQLSGTAEAVRQGAEHTAKAIKRIADGSISNEDVTRAI
VNAKFDFLETAQLQGPSMLLAGSGILNGGKASELASLARAFESVTKDQLTTAAKSLLKDKATVSTVGDLFVLPFA
DDIGLRV*
Coding >OphauG2|2290
ATGCTCTCGCGATTCGCCCTCGCGCGAAATTTACACCAGGTCGTCCGGCGGTCCTGCAGCGTCCATGCGCTCCAG
CATAGGGGCTTTGCTGCGGCAGCTTCTGCGAGTGCCTTTGATGTTTCCGATGTCTCTGGTATCAAGGTCGCTTCC
AGGGACAGTCATGGCCCGACAACTCGACTCGCCGTAGTCTCAAAGGCCGGCACCCGATATCAGCCATTCCCGGGG
CTTTGTGTCGGACTTGAAGAGTTCGCCTTCAAGAAAACGCGAAGACGGACTGCGCTTCGCATCACTCGTGAATCC
GAGCTGCTTGGAGCCCAATTGGCTGCTTCGCACACCCGTGAGGCGCTCCTAATCGAGGCTAGCTTCCTCCGCCAA
GACTTGCCTTACTTCGCCGAATTGTTGGCCGAGGTTATTTCAATGACCAATTATACCACATACGAATTCCATGAG
GATGTTGAGCGCGTGCTTGACCTCAAGCAGGCTGCTTTGAATTACGACGTGCCTGGGCTCGCCCTCGACACTGCT
CATGCAGTCGCCTTTCACACTGGCCTTGGTGCTCCAGTGTATCCCATGGGCTCGACACCTGTCAAAAAGTACCTG
AACGAAGAGTACATTGCAAGCTATGCCGACGTTGTATACTCCAAACCCAATATTGCTGTTGTCGCCGATGGCGCT
TCTGTCGAGCACATGGCCAAGTGGGTTGGTCATTTCTTCAGCGATGTTTCGGCTTCTCCCCGCAGTGGACAGACA
CTTAAGACTGAGCCATCTAAATATTACGGCGGTGAACAGCGGCTGAACCATGCTGCTGGGAATTCAATGGTGATT
GCATTTCCCGGTTCCGATATCAATGGATCAAAGCCCGAAATGGTGGTTCTTGCTGCGTTACTGGGTGGCAAGTCA
ACTATTAAGTGGTCTCCTGGCTTCAGTCTGCTTTCCAAGGCGGCAAGCGAAACACGCGGTCTCTCAGCCACATCC
AGGAACCTGGGATACTCGGATGCTGGTCTTGTTGTTGTGCAGCTCTCTGGAACGGCCGAAGCGGTTCGCCAGGGC
GCTGAACACACAGCAAAGGCCATCAAGAGGATTGCAGACGGGTCCATCAGTAACGAGGATGTGACGAGGGCGATT
GTCAATGCCAAGTTTGACTTTCTCGAAACGGCTCAGCTGCAAGGCCCAAGCATGTTACTGGCAGGGTCCGGCATA
CTGAACGGCGGGAAGGCATCGGAGCTGGCGTCTCTGGCCAGGGCATTCGAGTCGGTGACCAAAGATCAACTGACG
ACGGCGGCCAAATCACTGCTTAAAGATAAAGCGACAGTCTCGACTGTGGGTGATTTGTTCGTGCTTCCTTTTGCC
GATGATATTGGCCTGCGTGTATAA
Transcript >OphauG2|2290
ATGCTCTCGCGATTCGCCCTCGCGCGAAATTTACACCAGGTCGTCCGGCGGTCCTGCAGCGTCCATGCGCTCCAG
CATAGGGGCTTTGCTGCGGCAGCTTCTGCGAGTGCCTTTGATGTTTCCGATGTCTCTGGTATCAAGGTCGCTTCC
AGGGACAGTCATGGCCCGACAACTCGACTCGCCGTAGTCTCAAAGGCCGGCACCCGATATCAGCCATTCCCGGGG
CTTTGTGTCGGACTTGAAGAGTTCGCCTTCAAGAAAACGCGAAGACGGACTGCGCTTCGCATCACTCGTGAATCC
GAGCTGCTTGGAGCCCAATTGGCTGCTTCGCACACCCGTGAGGCGCTCCTAATCGAGGCTAGCTTCCTCCGCCAA
GACTTGCCTTACTTCGCCGAATTGTTGGCCGAGGTTATTTCAATGACCAATTATACCACATACGAATTCCATGAG
GATGTTGAGCGCGTGCTTGACCTCAAGCAGGCTGCTTTGAATTACGACGTGCCTGGGCTCGCCCTCGACACTGCT
CATGCAGTCGCCTTTCACACTGGCCTTGGTGCTCCAGTGTATCCCATGGGCTCGACACCTGTCAAAAAGTACCTG
AACGAAGAGTACATTGCAAGCTATGCCGACGTTGTATACTCCAAACCCAATATTGCTGTTGTCGCCGATGGCGCT
TCTGTCGAGCACATGGCCAAGTGGGTTGGTCATTTCTTCAGCGATGTTTCGGCTTCTCCCCGCAGTGGACAGACA
CTTAAGACTGAGCCATCTAAATATTACGGCGGTGAACAGCGGCTGAACCATGCTGCTGGGAATTCAATGGTGATT
GCATTTCCCGGTTCCGATATCAATGGATCAAAGCCCGAAATGGTGGTTCTTGCTGCGTTACTGGGTGGCAAGTCA
ACTATTAAGTGGTCTCCTGGCTTCAGTCTGCTTTCCAAGGCGGCAAGCGAAACACGCGGTCTCTCAGCCACATCC
AGGAACCTGGGATACTCGGATGCTGGTCTTGTTGTTGTGCAGCTCTCTGGAACGGCCGAAGCGGTTCGCCAGGGC
GCTGAACACACAGCAAAGGCCATCAAGAGGATTGCAGACGGGTCCATCAGTAACGAGGATGTGACGAGGGCGATT
GTCAATGCCAAGTTTGACTTTCTCGAAACGGCTCAGCTGCAAGGCCCAAGCATGTTACTGGCAGGGTCCGGCATA
CTGAACGGCGGGAAGGCATCGGAGCTGGCGTCTCTGGCCAGGGCATTCGAGTCGGTGACCAAAGATCAACTGACG
ACGGCGGCCAAATCACTGCTTAAAGATAAAGCGACAGTCTCGACTGTGGGTGATTTGTTCGTGCTTCCTTTTGCC
GATGATATTGGCCTGCGTGTATAA
Gene >OphauG2|2290
ATGCTCTCGCGATTCGCCCTCGCGCGAAATTTACACCAGGTCGTCCGGCGGTCCTGCAGCGTCCATGCGCTCCAG
CATAGGGGCTTTGCTGCGGCAGCTTCTGCGAGTGCCTTTGATGTTTCCGATGTCTCTGGTATCAAGGTCGCTTCC
AGGGACAGTCATGGCCCGACAACTCGACTCGCCGTAGTCTCAAAGGCCGGCACCCGATATCAGCCATTCCCGGGG
CTTTGTGTCGGACTTGAAGAGTTCGCCTTCAAGGTGAGCCTTTCCAGCCCAGCCCAGCCAATTCCTTAGTCGGGA
GCTCATGTTTGGCGCCATGTCACATTCAGAAAACGCGAAGACGGACTGCGCTTCGCATCACTCGTGAATCCGAGC
TGCTTGGAGCCCAATTGGCTGCTTCGCACACCCGTGAGGCGCTCCTAATCGAGGCTAGCTTCCTCCGCCAAGACT
TGCCTTACTTCGCCGAATTGTTGGCCGAGGTTATTTCAATGACCAATTATACCAGTAAGACTCTTGGTCACCGGT
TAAGATGGATGACAGAAACACCGAGTTAAGCTTGTCCCAGCATACGAATTCCATGAGGATGTTGAGCGCGTGCTT
GACCTCAAGCAGGCTGCTTTGAATTACGACGTGCCTGGGCTCGCCCTCGACACTGCTCATGCAGTCGCCTTTCAC
ACTGGCCTTGGTGCTCCAGTGTATCCCATGGGCTCGACACCTGTCAAAAAGTACCTGAACGAAGAGTACATTGCA
AGCTATGCCGACGTTGTATACTCCAAACCCAATATTGCTGTTGTCGCCGATGGCGCTTCTGTCGAGCACATGGCC
AAGTGGGTTGGTCATTTCTTCAGCGATGTTTCGGCTTCTCCCCGCAGTGGACAGACACTTAAGACTGAGCCATCT
AAATATTACGGCGGTGAACAGCGGCTGAACCATGCTGCTGGGAATTCAATGGTGATTGCATTTCCCGGTTCCGAT
ATCAATGGATCAAAGCCCGAAATGGTGGTTCTTGCTGCGTTACTGGGTGGCAAGTCAACTATTAAGTGGTCTCCT
GGCTTCAGTCTGCTTTCCAAGGCGGCAAGCGAAACACGCGGTCTCTCAGCCACATCCAGGAACCTGGGATACTCG
GATGCTGGTCTTGTTGTTGTGCAGCTCTCTGGAACGGCCGAAGCGGTTCGCCAGGGCGCTGAACACACAGCAAAG
GCCATCAAGAGGATTGCAGACGGGTCCATCAGTAACGAGGATGTGACGAGGGCGATTGTCAATGCCAAGTTTGAC
TTTCTCGAAACGGCTCAGCTGCAAGGCCCAAGCATGTTACTGGCAGGGTCCGGCATACTGAACGGCGGGAAGGCA
TCGGAGCTGGCGTCTCTGGCCAGGGCATTCGAGTCGGTGACCAAAGATCAACTGACGACGGTATGATGTCCCAAT
TCGTACTGTCTCCATGTTTAGAGTTGTAGCTGACCAATAATTGCAGGCGGCCAAATCACTGCTTAAAGATAAAGC
GACAGTCTCGACTGTGGGTGATTTGTTCGTGCTTCCTTTTGCCGATGATATTGGCCTGCGTGTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail