Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2280
Gene name
LocationContig_18:38601..40971
Strand+
Gene length (bp)2370
Transcript length (bp)2256
Coding sequence length (bp)2256
Protein length (aa) 752

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 2.3E-01 328 356
PF00400 WD40 WD domain, G-beta repeat 1.4E-02 679 709

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10990|CDT2_SCHPO Cell division cycle protein cdt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdt2 PE=1 SV=1 283 710 1.0E-30
sp|Q24371|L2DTL_DROME Protein lethal(2)denticleless OS=Drosophila melanogaster GN=l(2)dtl PE=1 SV=2 283 619 5.0E-17
sp|Q6P1W0|DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis GN=dtl PE=1 SV=1 295 723 6.0E-17
sp|Q4V837|DTLA_XENLA Denticleless protein homolog A OS=Xenopus laevis GN=dtl-a PE=2 SV=1 295 723 2.0E-16
sp|Q5RHI5|DTL_DANRE Denticleless protein homolog OS=Danio rerio GN=dtl PE=2 SV=1 297 710 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10990|CDT2_SCHPO Cell division cycle protein cdt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdt2 PE=1 SV=1 283 710 1.0E-30
sp|Q24371|L2DTL_DROME Protein lethal(2)denticleless OS=Drosophila melanogaster GN=l(2)dtl PE=1 SV=2 283 619 5.0E-17
sp|Q6P1W0|DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis GN=dtl PE=1 SV=1 295 723 6.0E-17
sp|Q4V837|DTLA_XENLA Denticleless protein homolog A OS=Xenopus laevis GN=dtl-a PE=2 SV=1 295 723 2.0E-16
sp|Q5RHI5|DTL_DANRE Denticleless protein homolog OS=Danio rerio GN=dtl PE=2 SV=1 297 710 3.0E-16
sp|Q5ZJW8|DTL_CHICK Denticleless protein homolog OS=Gallus gallus GN=DTL PE=2 SV=1 295 723 9.0E-16
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 250 424 1.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 295 408 4.0E-07
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 332 546 5.0E-07
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 332 490 5.0E-07
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 250 409 5.0E-06
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 332 425 8.0E-06
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 332 490 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1571
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2280 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5992
Ophiocordyceps camponoti-floridani Ophcf2|06778
Ophiocordyceps camponoti-rufipedis Ophun1|5909
Ophiocordyceps kimflemingae Ophio5|2620
Ophiocordyceps subramaniannii Hirsu2|1164

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2280
MQAETASSSSSPTHKSPTSASDHQLLSPPRTNRRKETRVPSVTPRRFRRFFTPRSLQLAESDRPARVTLGSLDPA
AINRRLQSPSSLADDNESLDGGFPSSPIEHLTVSEPRHAKRRRHSCHQAPPGAKRNRPAARLFACPENLSTSSTT
QNAPSQIIADEAQQLVATDNGQRNSLSNFFRTSRAAPQALLGKPFLHLHDQTLGLSQDRLPLLKTYKPTPIRKLA
NRGFHAQLLNREHGFSAFPGQQHIAYPAADPLIETASFYSGSEDTYVCAPMGAAGRSFPFCLASCHWYPITAIGD
DHGFVRFFDTRKSVRGRVPGGSDKVLAHHQFHENVVMDLDFSPDDSRLASASSDRSGKIMDMSTQTIAVNLDGGH
LDSMRQVAFRPDGSSGHVIATSDRAGRVQIWDLRCSSLPSTCFSTLSHGGRRRDDTLDIWPARTVNTIDNAHRRK
TSCSTSSASITTLRWLPGHQSHLILTGSEANASIKLWDTRFIKPRRQTEDMPLSVTAEPPTHKWRSYGITSMALS
TDASRLYAVCKDNTVYAYSTAHLKLGSAPELSSGSIRHRPTAAEGLGPILGFRHDALRVSSFYVKCAVRPAINGE
KELLAVGSSESCAVLFPTDDRYVRNVWSQRQHMPNNVSNSTLTTTTPPLTPCTSSTSFSSSLMSTVSSPPISRIG
TALIRGHTREVTSLSWSCQGRLVSASDDFFVRHWQEDASRARHLRQVGEFGGERNLSGWAEVAEDWDGANDVGDM
V*
Coding >OphauG2|2280
ATGCAAGCGGAAACTGCTTCTTCTTCTTCAAGCCCGACTCACAAATCTCCTACCTCGGCATCCGACCATCAGCTT
CTATCACCTCCGCGAACTAATCGACGGAAGGAGACTCGTGTACCATCTGTCACTCCCAGGCGTTTCCGCAGATTT
TTCACCCCGCGGTCGCTTCAATTGGCCGAATCAGATCGACCGGCCCGCGTAACCCTCGGCTCTCTAGACCCTGCT
GCTATCAACAGACGCCTTCAGTCACCATCTTCTCTCGCTGACGATAACGAGAGCTTAGATGGCGGGTTTCCCTCA
TCGCCCATCGAGCATCTGACAGTATCAGAGCCAAGGCATGCCAAGAGGCGGAGGCATAGTTGTCATCAGGCGCCT
CCCGGAGCTAAAAGGAACAGGCCTGCTGCTCGGCTCTTTGCTTGCCCGGAAAACTTGTCCACCTCTTCCACCACT
CAGAACGCACCATCTCAAATCATAGCAGATGAAGCGCAACAGCTCGTCGCCACCGACAATGGACAGAGAAACTCC
CTGAGCAACTTCTTCAGGACTAGTCGTGCTGCTCCCCAAGCTTTGCTTGGTAAACCTTTTTTACACCTGCATGAT
CAAACGCTTGGGCTTTCACAAGACCGGCTCCCGCTCCTTAAAACATACAAGCCGACTCCAATACGCAAACTTGCA
AATCGCGGCTTCCACGCGCAACTTCTAAACCGCGAACATGGCTTCTCTGCCTTTCCTGGCCAACAGCATATCGCC
TATCCGGCCGCGGATCCCCTTATCGAGACTGCTTCTTTTTACAGCGGCAGCGAAGATACTTACGTCTGTGCGCCG
ATGGGTGCTGCCGGGAGATCATTCCCTTTTTGTCTCGCTAGCTGTCACTGGTATCCCATCACCGCCATTGGCGAC
GACCATGGCTTTGTTCGCTTTTTTGATACCAGAAAATCTGTTCGAGGCAGGGTGCCCGGAGGCAGTGACAAAGTC
TTGGCCCACCATCAATTTCACGAAAATGTTGTTATGGACCTGGACTTTTCGCCCGATGATAGCCGCTTGGCAAGC
GCCAGCAGCGACCGATCAGGAAAAATCATGGACATGAGCACTCAAACCATTGCAGTGAATCTGGACGGAGGACAC
TTGGACTCGATGCGGCAAGTGGCATTTCGACCTGACGGGAGCAGCGGCCATGTCATTGCCACATCGGACAGGGCG
GGGCGCGTGCAGATCTGGGACTTGCGATGCTCGTCGCTTCCATCCACTTGCTTCTCTACACTTTCTCATGGCGGT
CGGCGTCGCGATGACACTCTGGATATCTGGCCGGCCCGGACGGTCAACACCATAGACAATGCTCATCGCCGCAAG
ACGTCTTGCAGCACCTCGTCAGCATCCATCACCACCCTTCGATGGCTGCCCGGTCACCAAAGCCATTTGATTCTT
ACTGGCTCAGAAGCAAATGCGTCCATCAAGCTCTGGGATACGCGCTTCATTAAGCCTCGCCGCCAGACCGAAGAT
ATGCCCCTCTCCGTCACGGCTGAGCCCCCTACCCACAAATGGCGCTCCTACGGAATCACTTCGATGGCTCTCAGC
ACTGATGCCTCGCGTCTTTATGCTGTATGCAAGGACAACACCGTCTACGCATACTCAACTGCTCATCTCAAGCTT
GGCTCAGCACCAGAGCTGTCCTCTGGCTCCATCCGACATCGACCTACTGCGGCAGAGGGCCTCGGTCCCATTCTC
GGATTCAGACACGACGCCCTGCGTGTCTCATCTTTCTACGTCAAATGTGCCGTGCGGCCCGCTATCAACGGGGAA
AAAGAACTCTTGGCTGTCGGCAGCTCCGAGTCATGTGCCGTGCTCTTCCCAACCGACGATCGATACGTCCGCAAT
GTCTGGTCTCAACGGCAGCACATGCCCAATAATGTCTCGAATTCGACATTAACAACGACGACCCCCCCTCTGACG
CCTTGTACGTCATCGACATCGTTCTCGTCTAGCTTGATGTCCACTGTTTCATCACCACCTATATCCCGCATCGGC
ACTGCTCTAATCCGCGGCCATACTCGGGAGGTGACTTCTCTCAGCTGGTCATGCCAGGGCCGCCTTGTCAGCGCC
TCTGATGATTTTTTTGTTCGCCACTGGCAGGAAGATGCCTCTCGCGCACGCCATCTTCGCCAAGTGGGCGAGTTT
GGGGGCGAGCGCAATCTTTCTGGCTGGGCTGAAGTTGCAGAAGATTGGGACGGTGCTAACGATGTCGGTGACATG
GTTTGA
Transcript >OphauG2|2280
ATGCAAGCGGAAACTGCTTCTTCTTCTTCAAGCCCGACTCACAAATCTCCTACCTCGGCATCCGACCATCAGCTT
CTATCACCTCCGCGAACTAATCGACGGAAGGAGACTCGTGTACCATCTGTCACTCCCAGGCGTTTCCGCAGATTT
TTCACCCCGCGGTCGCTTCAATTGGCCGAATCAGATCGACCGGCCCGCGTAACCCTCGGCTCTCTAGACCCTGCT
GCTATCAACAGACGCCTTCAGTCACCATCTTCTCTCGCTGACGATAACGAGAGCTTAGATGGCGGGTTTCCCTCA
TCGCCCATCGAGCATCTGACAGTATCAGAGCCAAGGCATGCCAAGAGGCGGAGGCATAGTTGTCATCAGGCGCCT
CCCGGAGCTAAAAGGAACAGGCCTGCTGCTCGGCTCTTTGCTTGCCCGGAAAACTTGTCCACCTCTTCCACCACT
CAGAACGCACCATCTCAAATCATAGCAGATGAAGCGCAACAGCTCGTCGCCACCGACAATGGACAGAGAAACTCC
CTGAGCAACTTCTTCAGGACTAGTCGTGCTGCTCCCCAAGCTTTGCTTGGTAAACCTTTTTTACACCTGCATGAT
CAAACGCTTGGGCTTTCACAAGACCGGCTCCCGCTCCTTAAAACATACAAGCCGACTCCAATACGCAAACTTGCA
AATCGCGGCTTCCACGCGCAACTTCTAAACCGCGAACATGGCTTCTCTGCCTTTCCTGGCCAACAGCATATCGCC
TATCCGGCCGCGGATCCCCTTATCGAGACTGCTTCTTTTTACAGCGGCAGCGAAGATACTTACGTCTGTGCGCCG
ATGGGTGCTGCCGGGAGATCATTCCCTTTTTGTCTCGCTAGCTGTCACTGGTATCCCATCACCGCCATTGGCGAC
GACCATGGCTTTGTTCGCTTTTTTGATACCAGAAAATCTGTTCGAGGCAGGGTGCCCGGAGGCAGTGACAAAGTC
TTGGCCCACCATCAATTTCACGAAAATGTTGTTATGGACCTGGACTTTTCGCCCGATGATAGCCGCTTGGCAAGC
GCCAGCAGCGACCGATCAGGAAAAATCATGGACATGAGCACTCAAACCATTGCAGTGAATCTGGACGGAGGACAC
TTGGACTCGATGCGGCAAGTGGCATTTCGACCTGACGGGAGCAGCGGCCATGTCATTGCCACATCGGACAGGGCG
GGGCGCGTGCAGATCTGGGACTTGCGATGCTCGTCGCTTCCATCCACTTGCTTCTCTACACTTTCTCATGGCGGT
CGGCGTCGCGATGACACTCTGGATATCTGGCCGGCCCGGACGGTCAACACCATAGACAATGCTCATCGCCGCAAG
ACGTCTTGCAGCACCTCGTCAGCATCCATCACCACCCTTCGATGGCTGCCCGGTCACCAAAGCCATTTGATTCTT
ACTGGCTCAGAAGCAAATGCGTCCATCAAGCTCTGGGATACGCGCTTCATTAAGCCTCGCCGCCAGACCGAAGAT
ATGCCCCTCTCCGTCACGGCTGAGCCCCCTACCCACAAATGGCGCTCCTACGGAATCACTTCGATGGCTCTCAGC
ACTGATGCCTCGCGTCTTTATGCTGTATGCAAGGACAACACCGTCTACGCATACTCAACTGCTCATCTCAAGCTT
GGCTCAGCACCAGAGCTGTCCTCTGGCTCCATCCGACATCGACCTACTGCGGCAGAGGGCCTCGGTCCCATTCTC
GGATTCAGACACGACGCCCTGCGTGTCTCATCTTTCTACGTCAAATGTGCCGTGCGGCCCGCTATCAACGGGGAA
AAAGAACTCTTGGCTGTCGGCAGCTCCGAGTCATGTGCCGTGCTCTTCCCAACCGACGATCGATACGTCCGCAAT
GTCTGGTCTCAACGGCAGCACATGCCCAATAATGTCTCGAATTCGACATTAACAACGACGACCCCCCCTCTGACG
CCTTGTACGTCATCGACATCGTTCTCGTCTAGCTTGATGTCCACTGTTTCATCACCACCTATATCCCGCATCGGC
ACTGCTCTAATCCGCGGCCATACTCGGGAGGTGACTTCTCTCAGCTGGTCATGCCAGGGCCGCCTTGTCAGCGCC
TCTGATGATTTTTTTGTTCGCCACTGGCAGGAAGATGCCTCTCGCGCACGCCATCTTCGCCAAGTGGGCGAGTTT
GGGGGCGAGCGCAATCTTTCTGGCTGGGCTGAAGTTGCAGAAGATTGGGACGGTGCTAACGATGTCGGTGACATG
GTTTGA
Gene >OphauG2|2280
ATGCAAGCGGAAACTGCTTCTTCTTCTTCAAGCCCGACTCACAAATCTCCTACCTCGGCATCCGACCATCAGCTT
CTATCACCTCCGCGAACTAATCGACGGAAGGAGACTCGTGTACCATCTGTCACTCCCAGGCGTTTCCGCAGATTT
TTCACCCCGCGGTCGCTTCAATTGGCCGAATCAGATCGACCGGCCCGCGTAACCCTCGGCTCTCTAGACCCTGCT
GCTATCAACAGACGCCTTCAGTCACCATCTTCTCTCGCTGACGATAACGAGAGCTTAGATGGCGGGTTTCCCTCA
TCGCCCATCGAGCATCTGACAGTATCAGAGCCAAGGCATGCCAAGAGGCGGAGGCATAGTTGTCATCAGGCGCCT
CCCGGAGCTAAAAGGAACAGGCCTGCTGCTCGGCTCTTTGCTTGCCCGGAAAACTTGTCCACCTCTTCCACCACT
CAGAACGCACCATCTCAAATCATAGCAGATGAAGCGCAACAGCTCGTCGCCACCGACAATGGACAGAGAAACTCC
CTGGTGAGGCCCCTTGCCTCTTGTGCTGGAGATAGATGCATCTTGTTGACACGTCTCAGAGCAACTTCTTCAGGA
CTAGTCGTGCTGCTCCCCAAGCTTTGCTTGGTAAACCTTTTTTACACCTGCATGATCAAACGCTTGGGCTTTCAC
AAGACCGGCTCCCGGTAGGGTCATTACGTTTGGTGCTTGTTCAGCGCTTGCGATGCTAATACACGGCGACAGCTC
CTTAAAACATACAAGCCGACTCCAATACGCAAACTTGCAAATCGCGGCTTCCACGCGCAACTTCTAAACCGCGAA
CATGGCTTCTCTGCCTTTCCTGGCCAACAGCATATCGCCTATCCGGCCGCGGATCCCCTTATCGAGACTGCTTCT
TTTTACAGCGGCAGCGAAGATACTTACGTCTGTGCGCCGATGGGTGCTGCCGGGAGATCATTCCCTTTTTGTCTC
GCTAGCTGTCACTGGTATCCCATCACCGCCATTGGCGACGACCATGGCTTTGTTCGCTTTTTTGATACCAGAAAA
TCTGTTCGAGGCAGGGTGCCCGGAGGCAGTGACAAAGTCTTGGCCCACCATCAATTTCACGAAAATGTTGTTATG
GACCTGGACTTTTCGCCCGATGATAGCCGCTTGGCAAGCGCCAGCAGCGACCGATCAGGAAAAATCATGGACATG
AGCACTCAAACCATTGCAGTGAATCTGGACGGAGGACACTTGGACTCGATGCGGCAAGTGGCATTTCGACCTGAC
GGGAGCAGCGGCCATGTCATTGCCACATCGGACAGGGCGGGGCGCGTGCAGATCTGGGACTTGCGATGCTCGTCG
CTTCCATCCACTTGCTTCTCTACACTTTCTCATGGCGGTCGGCGTCGCGATGACACTCTGGATATCTGGCCGGCC
CGGACGGTCAACACCATAGACAATGCTCATCGCCGCAAGACGTCTTGCAGCACCTCGTCAGCATCCATCACCACC
CTTCGATGGCTGCCCGGTCACCAAAGCCATTTGATTCTTACTGGCTCAGAAGCAAATGCGTCCATCAAGCTCTGG
GATACGCGCTTCATTAAGCCTCGCCGCCAGACCGAAGATATGCCCCTCTCCGTCACGGCTGAGCCCCCTACCCAC
AAATGGCGCTCCTACGGAATCACTTCGATGGCTCTCAGCACTGATGCCTCGCGTCTTTATGCTGTATGCAAGGAC
AACACCGTCTACGCATACTCAACTGCTCATCTCAAGCTTGGCTCAGCACCAGAGCTGTCCTCTGGCTCCATCCGA
CATCGACCTACTGCGGCAGAGGGCCTCGGTCCCATTCTCGGATTCAGACACGACGCCCTGCGTGTCTCATCTTTC
TACGTCAAATGTGCCGTGCGGCCCGCTATCAACGGGGAAAAAGAACTCTTGGCTGTCGGCAGCTCCGAGTCATGT
GCCGTGCTCTTCCCAACCGACGATCGATACGTCCGCAATGTCTGGTCTCAACGGCAGCACATGCCCAATAATGTC
TCGAATTCGACATTAACAACGACGACCCCCCCTCTGACGCCTTGTACGTCATCGACATCGTTCTCGTCTAGCTTG
ATGTCCACTGTTTCATCACCACCTATATCCCGCATCGGCACTGCTCTAATCCGCGGCCATACTCGGGAGGTGACT
TCTCTCAGCTGGTCATGCCAGGGCCGCCTTGTCAGCGCCTCTGATGATTTTTTTGTTCGCCACTGGCAGGAAGAT
GCCTCTCGCGCACGCCATCTTCGCCAAGTGGGCGAGTTTGGGGGCGAGCGCAATCTTTCTGGCTGGGCTGAAGTT
GCAGAAGATTGGGACGGTGCTAACGATGTCGGTGACATGGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail