Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2265
Gene name
LocationContig_1798:876..1330
Strand-
Gene length (bp)454
Transcript length (bp)222
Coding sequence length (bp)222
Protein length (aa) 74

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17) 5.6E-21 25 73

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12287|COX17_YEAST Cytochrome c oxidase copper chaperone OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX17 PE=1 SV=3 20 73 2.0E-13
sp|Q9P7Z7|COX17_SCHPO Cytochrome c oxidase copper chaperone OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox17 PE=3 SV=1 4 73 1.0E-09
sp|P81045|COX17_PIG Cytochrome c oxidase copper chaperone OS=Sus scrofa GN=COX17 PE=1 SV=1 8 73 2.0E-06
sp|Q6J3Q7|COX17_CANLF Cytochrome c oxidase copper chaperone OS=Canis lupus familiaris GN=COX17 PE=3 SV=3 8 73 2.0E-06
sp|Q14061|COX17_HUMAN Cytochrome c oxidase copper chaperone OS=Homo sapiens GN=COX17 PE=1 SV=2 10 73 6.0E-06

GO

GO Term Description Terminal node
GO:0005758 mitochondrial intermembrane space Yes
GO:0016531 copper chaperone activity Yes
GO:0005507 copper ion binding Yes
GO:0046872 metal ion binding No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0016530 metallochaperone activity No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0140104 molecular carrier activity No
GO:0070013 intracellular organelle lumen No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0043233 organelle lumen No
GO:0031970 organelle envelope lumen No
GO:0031974 membrane-enclosed lumen No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6952
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2265 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4317
Ophiocordyceps subramaniannii Hirsu2|1149

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2265
MEAPSSTPSGSAPSPTAPTADSSSKPKPCCVCKDEKARRDECMLFSTAQDAAQDCRSLVDQYKSCMLGYGFKV*
Coding >OphauG2|2265
ATGGAGGCTCCGTCTTCAACCCCGTCTGGTTCAGCTCCCTCTCCCACTGCTCCAACCGCAGACTCGTCCTCCAAG
CCCAAGCCATGTTGCGTCTGCAAGGACGAAAAGGCTAGGCGTGACGAATGCATGCTCTTCTCCACGGCCCAAGAC
GCCGCCCAAGACTGCAGGTCCTTGGTCGACCAGTATAAAAGCTGTATGCTTGGCTATGGATTCAAGGTTTAA
Transcript >OphauG2|2265
ATGGAGGCTCCGTCTTCAACCCCGTCTGGTTCAGCTCCCTCTCCCACTGCTCCAACCGCAGACTCGTCCTCCAAG
CCCAAGCCATGTTGCGTCTGCAAGGACGAAAAGGCTAGGCGTGACGAATGCATGCTCTTCTCCACGGCCCAAGAC
GCCGCCCAAGACTGCAGGTCCTTGGTCGACCAGTATAAAAGCTGTATGCTTGGCTATGGATTCAAGGTTTAA
Gene >OphauG2|2265
ATGGAGGCTCCGTCTTCAACCCCGTCTGGTTGTACGTCACTGCTCGCATTACCAGCACTTTCTTAACCAATCATG
CACCCCATCCCTCAAAACACTTGTCCCCCAAACCCTTCCCCTTAACCAAGCAGCCTGGAATCCTTTTTCTTTGAT
CCTCCTATTTTTCCGGAGAAGAAGAAGAAAAAAAAACTGCTAACCCAGCATACCAGCAGCTCCCTCTCCCACTGC
TCCAACCGCAGACTCGTCCTCCAAGCCCAAGGTGCGCCGCCCTCGCTCTCTCTTCAGCCTCGACGGATTGCTTAC
TCGCGACTTGTAGCCATGTTGCGTCTGCAAGGACGAAAAGGCTAGGCGTGACGAATGCATGCTCTTCTCCACGGC
CCAAGACGCCGCCCAAGACTGCAGGTCCTTGGTCGACCAGTATAAAAGCTGTATGCTTGGCTATGGATTCAAGGT
TTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail