Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2262
Gene name
LocationContig_1796:195..2039
Strand+
Gene length (bp)1844
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00928 Adap_comp_sub Adaptor complexes medium subunit family 5.8E-15 274 494
PF01217 Clat_adaptor_s Clathrin adaptor complex small chain 1.3E-07 8 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RA77|COPD_PONAB Coatomer subunit delta OS=Pongo abelii GN=ARCN1 PE=2 SV=1 1 511 5.0E-119
sp|Q66H80|COPD_RAT Coatomer subunit delta OS=Rattus norvegicus GN=Arcn1 PE=2 SV=1 1 511 5.0E-119
sp|P48444|COPD_HUMAN Coatomer subunit delta OS=Homo sapiens GN=ARCN1 PE=1 SV=1 1 511 6.0E-119
sp|Q5XJY5|COPD_MOUSE Coatomer subunit delta OS=Mus musculus GN=Arcn1 PE=1 SV=2 1 511 2.0E-118
sp|P53619|COPD_BOVIN Coatomer subunit delta OS=Bos taurus GN=ARCN1 PE=1 SV=1 1 511 3.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RA77|COPD_PONAB Coatomer subunit delta OS=Pongo abelii GN=ARCN1 PE=2 SV=1 1 511 5.0E-119
sp|Q66H80|COPD_RAT Coatomer subunit delta OS=Rattus norvegicus GN=Arcn1 PE=2 SV=1 1 511 5.0E-119
sp|P48444|COPD_HUMAN Coatomer subunit delta OS=Homo sapiens GN=ARCN1 PE=1 SV=1 1 511 6.0E-119
sp|Q5XJY5|COPD_MOUSE Coatomer subunit delta OS=Mus musculus GN=Arcn1 PE=1 SV=2 1 511 2.0E-118
sp|P53619|COPD_BOVIN Coatomer subunit delta OS=Bos taurus GN=ARCN1 PE=1 SV=1 1 511 3.0E-118
sp|Q5ZL57|COPD_CHICK Coatomer subunit delta OS=Gallus gallus GN=ARCN1 PE=2 SV=1 1 511 1.0E-116
sp|Q0DJA0|COPD1_ORYSJ Coatomer subunit delta-1 OS=Oryza sativa subsp. japonica GN=Os05g0310800 PE=2 SV=1 1 511 2.0E-90
sp|Q0DJ99|COPD2_ORYSJ Coatomer subunit delta-2 OS=Oryza sativa subsp. japonica GN=Os05g0311000 PE=2 SV=1 1 511 4.0E-90
sp|P43621|COPD_YEAST Coatomer subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RET2 PE=1 SV=3 1 477 9.0E-90
sp|O74496|COPD_SCHPO Coatomer subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ret2 PE=3 SV=1 1 236 6.0E-89
sp|Q09236|COPD_CAEEL Probable coatomer subunit delta OS=Caenorhabditis elegans GN=C13B9.3 PE=3 SV=1 1 511 3.0E-88
sp|P49661|COPD3_ORYSJ Coatomer subunit delta-3 OS=Oryza sativa subsp. japonica GN=Os01g0833700 PE=2 SV=2 1 511 3.0E-85
sp|Q93Y22|COPD_ARATH Coatomer subunit delta OS=Arabidopsis thaliana GN=At5g05010 PE=1 SV=2 1 511 4.0E-79
sp|Q55EZ6|COPD_DICDI Coatomer subunit delta OS=Dictyostelium discoideum GN=copd PE=3 SV=1 1 178 1.0E-51
sp|Q55EZ6|COPD_DICDI Coatomer subunit delta OS=Dictyostelium discoideum GN=copd PE=3 SV=1 271 512 5.0E-29
sp|Q0J649|COPD4_ORYSJ Coatomer subunit delta-4 OS=Oryza sativa subsp. japonica GN=Os08g0368000 PE=2 SV=1 218 511 4.0E-26
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2262
MVILAASICTRGGKAVLSRQFREMPRSRIEALLASFPKLADSGTQHTTVEQDSVRFVYQPLDELYMVLITNRQSN
ILQDIDSLHLFAQVVTSACKSLDEREILKNAYEMLSAFDEMVALGYRENVALSQIKTFLDMESHEERIQDIIARN
KELEATEERKRKAKQLEVQRKESARTGRGAVSRTPVYPSYQSASRPSAPDSYDTYEAEKNKTYNKPIAPRGKGMQ
LGKKSKTTDMFERVRGDMGPEMEAAPLVTPSSGAAAELAEPRVSSTLDRDAIHVTISENITAKLSREGAVNSLAI
SGDLTLRISDPGLTKVKLALEATASHGTQFRTHPNVDRNAFHNSKVIQMSNTARGFPVNNAVGVLRWRASPKTDD
VSACPITFTVWINREAGKFNVTVEYELTGGEALRDVSVVVPYSGSEPVVASFDAAYDVSGDTLEWNIGSLDSDNA
NGSFEFEANSSDENDFFPMTVRFSKTTPYIKVDVTEVSLLEEKEAVTFSKDIKSHAEHFQIE*
Coding >OphauG2|2262
ATGGTCATTCTTGCAGCTTCGATTTGCACCCGCGGAGGGAAAGCTGTCCTATCCAGACAGTTTCGCGAGATGCCA
AGGTCGCGAATAGAAGCCCTTCTCGCATCATTTCCAAAGTTGGCCGACAGTGGCACGCAGCACACGACGGTCGAG
CAAGATAGTGTCCGATTCGTCTACCAACCGCTCGACGAGCTTTACATGGTGCTTATCACCAATCGCCAATCCAAT
ATTCTGCAAGACATTGATTCACTGCACCTCTTTGCACAAGTCGTGACCAGTGCATGCAAGTCTCTGGATGAGAGG
GAAATCCTCAAGAATGCCTACGAAATGCTTAGCGCCTTCGATGAGATGGTTGCTCTGGGCTATCGCGAAAACGTG
GCCCTGAGTCAGATCAAGACTTTTCTTGATATGGAAAGCCACGAGGAGCGCATCCAGGACATCATTGCCAGAAAC
AAAGAACTCGAGGCCACTGAAGAGCGGAAACGAAAAGCAAAGCAACTCGAGGTGCAACGAAAGGAATCTGCGCGT
ACGGGCCGCGGGGCTGTGTCGAGGACACCAGTCTATCCTTCTTACCAGTCTGCCTCGCGACCCAGCGCTCCGGAC
TCGTACGACACTTACGAGGCGGAGAAGAACAAGACATATAACAAGCCAATTGCCCCCAGAGGTAAGGGCATGCAG
CTGGGCAAGAAATCTAAGACAACGGACATGTTTGAGCGCGTTCGCGGAGATATGGGTCCCGAAATGGAAGCGGCG
CCCCTCGTGACGCCCTCTTCCGGAGCGGCCGCTGAGCTGGCTGAGCCACGTGTGTCATCAACACTAGACCGCGAC
GCTATTCACGTAACCATTTCTGAGAACATTACTGCAAAACTATCTCGCGAGGGTGCTGTTAATTCGTTGGCTATT
AGCGGAGACCTCACCCTACGCATTTCGGACCCTGGGCTGACCAAGGTCAAGCTGGCGCTCGAAGCTACCGCATCT
CATGGCACACAATTCCGTACACATCCCAACGTCGATCGCAACGCCTTCCATAATTCCAAGGTGATACAAATGAGT
AACACGGCCCGTGGGTTCCCTGTCAACAACGCTGTCGGGGTGCTGCGGTGGAGGGCTTCGCCAAAAACAGATGAC
GTGAGCGCCTGCCCGATTACCTTTACAGTTTGGATCAATCGAGAGGCGGGCAAATTCAACGTGACGGTCGAGTAT
GAATTAACGGGTGGGGAAGCACTGAGAGACGTTAGCGTTGTAGTGCCATATTCTGGCAGTGAGCCTGTCGTGGCA
AGTTTTGACGCTGCCTACGACGTGTCTGGTGACACGCTCGAGTGGAATATCGGGTCGTTGGACAGTGACAATGCC
AACGGCTCATTCGAGTTTGAAGCAAACAGCAGTGACGAGAACGACTTTTTCCCTATGACTGTGAGGTTCAGCAAG
ACAACGCCCTATATTAAGGTTGATGTGACTGAGGTATCGTTGCTAGAAGAGAAAGAAGCGGTGACATTTTCTAAG
GATATTAAGTCACATGCAGAACACTTTCAAATTGAGTAA
Transcript >OphauG2|2262
ATGGTCATTCTTGCAGCTTCGATTTGCACCCGCGGAGGGAAAGCTGTCCTATCCAGACAGTTTCGCGAGATGCCA
AGGTCGCGAATAGAAGCCCTTCTCGCATCATTTCCAAAGTTGGCCGACAGTGGCACGCAGCACACGACGGTCGAG
CAAGATAGTGTCCGATTCGTCTACCAACCGCTCGACGAGCTTTACATGGTGCTTATCACCAATCGCCAATCCAAT
ATTCTGCAAGACATTGATTCACTGCACCTCTTTGCACAAGTCGTGACCAGTGCATGCAAGTCTCTGGATGAGAGG
GAAATCCTCAAGAATGCCTACGAAATGCTTAGCGCCTTCGATGAGATGGTTGCTCTGGGCTATCGCGAAAACGTG
GCCCTGAGTCAGATCAAGACTTTTCTTGATATGGAAAGCCACGAGGAGCGCATCCAGGACATCATTGCCAGAAAC
AAAGAACTCGAGGCCACTGAAGAGCGGAAACGAAAAGCAAAGCAACTCGAGGTGCAACGAAAGGAATCTGCGCGT
ACGGGCCGCGGGGCTGTGTCGAGGACACCAGTCTATCCTTCTTACCAGTCTGCCTCGCGACCCAGCGCTCCGGAC
TCGTACGACACTTACGAGGCGGAGAAGAACAAGACATATAACAAGCCAATTGCCCCCAGAGGTAAGGGCATGCAG
CTGGGCAAGAAATCTAAGACAACGGACATGTTTGAGCGCGTTCGCGGAGATATGGGTCCCGAAATGGAAGCGGCG
CCCCTCGTGACGCCCTCTTCCGGAGCGGCCGCTGAGCTGGCTGAGCCACGTGTGTCATCAACACTAGACCGCGAC
GCTATTCACGTAACCATTTCTGAGAACATTACTGCAAAACTATCTCGCGAGGGTGCTGTTAATTCGTTGGCTATT
AGCGGAGACCTCACCCTACGCATTTCGGACCCTGGGCTGACCAAGGTCAAGCTGGCGCTCGAAGCTACCGCATCT
CATGGCACACAATTCCGTACACATCCCAACGTCGATCGCAACGCCTTCCATAATTCCAAGGTGATACAAATGAGT
AACACGGCCCGTGGGTTCCCTGTCAACAACGCTGTCGGGGTGCTGCGGTGGAGGGCTTCGCCAAAAACAGATGAC
GTGAGCGCCTGCCCGATTACCTTTACAGTTTGGATCAATCGAGAGGCGGGCAAATTCAACGTGACGGTCGAGTAT
GAATTAACGGGTGGGGAAGCACTGAGAGACGTTAGCGTTGTAGTGCCATATTCTGGCAGTGAGCCTGTCGTGGCA
AGTTTTGACGCTGCCTACGACGTGTCTGGTGACACGCTCGAGTGGAATATCGGGTCGTTGGACAGTGACAATGCC
AACGGCTCATTCGAGTTTGAAGCAAACAGCAGTGACGAGAACGACTTTTTCCCTATGACTGTGAGGTTCAGCAAG
ACAACGCCCTATATTAAGGTTGATGTGACTGAGGTATCGTTGCTAGAAGAGAAAGAAGCGGTGACATTTTCTAAG
GATATTAAGTCACATGCAGAACACTTTCAAATTGAGTAA
Gene >OphauG2|2262
ATGGTGCGCAGAAATGCTTAGTACCCGTTTTCACTTGGCTCAAGGCGTCTAGAACTGACATCGATCTGCCATTTG
CCCTGGCTTAGGTCATTCTTGCAGCTTCGATTTGCACCCGCGGAGGGAAAGCTGTCCTATCCAGACAGTTTCGCG
AGATGCCAAGGTCGCGAATAGAAGCCCTTCTCGCATCATTTCCAAAGTTGGCCGACAGTGGCACGCAGCACACGA
CGGTCGAGCAAGATAGTGTCCGATTCGTCTACCAACCGCTCGACGAGCTTTACATGGTGCTTATCACCAATCGCC
AATCCAATATTCTGCAAGACATTGATTCACTGCACCTCTTTGCACAAGTCGTGACCAGTGCATGCAAGTCTCTGG
ATGAGAGGGAAATCCTCAAGAATGCCTACGAAATGCTTAGCGCCTTCGATGAGATGGTTGCTCTGGGCTATCGCG
AAAACGTGGCCCTGAGTCAGATCAAGACTTTTCTTGATATGGAAAGCCACGAGGAGCGCATCCAGGACATCATTG
CCAGAGTCCGTTCATATATATACCCTCAACCGTAAGCTTTGCGCACCGCGTTCTGACCTTGCTGGTCCTACAGAA
CAAAGAACTCGAGGCCACTGAAGAGCGGAAACGAAAAGCAAAGCAACTCGAGGTGCAACGAAAGGAATCTGCGCG
TACGGGCCGCGGGGCTGTGTCGAGGACACCAGTCTATCCTTCTTACCAGTCTGCCTCGCGACCCAGCGCTCCGGA
CTCGTACGACACTTACGAGGCGGAGAAGAACAAGACATATAACAAGTACGTGTGCCTCAGGCTTTTTTTACTCGT
ATTTATTGCTTCTCGCAAAGGGCTCGGAAAATCTATTCGCGGGCGACCAGGGAGCTAACCGACTGTAAGGCCAAT
TGCCCCCAGAGGTAAGGGCATGCAGCTGGGCAAGAAATCTAAGACAACGGACATGTTTGAGCGCGTTCGCGGAGA
TATGGGTCCCGAAATGGAAGCGGCGCCCCTCGTGACGCCCTCTTCCGGAGCGGCCGCTGAGCTGGCTGAGCCACG
TGTGTCATCAACACTAGACCGCGACGCTATTCACGTAACCATTTCTGAGAACATTACTGCAAAACTATCTCGCGA
GGGTGCTGTTAATTCGTTGGCTATTAGCGGAGACCTCACCCTACGCATTTCGGACCCTGGGCTGACCAAGGTCAA
GCTGGCGCTCGAAGCTACCGCATCTCATGGCACACAATTCCGTACACATCCCAACGTCGATCGCAACGCCTTCCA
TAATTCCAAGGTGATACAAATGAGTAACACGGCCCGTGGGTTCCCTGTCAACAACGCTGTCGGGGTGCTGCGGTG
GAGGGCTTCGCCAAAAACAGATGACGTGAGCGCCTGCCCGATTACCTTTACAGTTTGGATCAATCGAGAGGCGGG
CAAATTCAACGTGACGGTCGAGTATGAATTAACGGGTGGGGAAGCACTGAGAGACGTTAGCGTTGTAGTGCCATA
TTCTGGCAGTGAGCCTGTCGTGGCAAGTTTTGACGCTGCCTACGACGTGTCTGGTGACACGCTCGAGTGGAATAT
CGGGTCGTTGGACAGTGACAATGCCAACGGCTCATTCGAGTTTGAAGCAAACAGCAGTGACGAGAACGACTTTTT
CCCTATGACTGTGAGGTTCAGCAAGACAACGCCCTATATTAAGGTTGATGTATGTTTCTATCTTGTTTCCCCGTG
CCATGGCACATTCACTAACAAGGCGCTAGGTGACTGAGGTATCGTTGCTAGAAGAGAAAGAAGCGGTGACATTTT
CTAAGGATATTAAGTCACATGCAGAACACTTTCAAATTGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail