Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2241
Gene name
LocationContig_1783:85..1123
Strand-
Gene length (bp)1038
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2549
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2241 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5099
Ophiocordyceps camponoti-floridani Ophcf2|00782
Ophiocordyceps camponoti-rufipedis Ophun1|5258
Ophiocordyceps kimflemingae Ophio5|2610
Ophiocordyceps subramaniannii Hirsu2|3776

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2241
MPPSPAPPPRPRARDRETDIDISLSKNRTEVDIYQSNSRPRSKSRDRRSRYHEDDIVVRRDGERLRVDEHSSSSR
RRAQSAAPSTIPFDDKADQIIAKIDSRGRMGESRGGATKDWTIVDVPPGTERVRMDGIGGASTDTTWERYSGVRR
TQFIPERDGALVPRDPSPAPARDRSSMAVYDREREIDVDIDRRVTRSPLPPPPPPAPAKDMWTEITKDLVMREAI
EELGYEYEETREFFYIMDYLKYEDVCELTERSESIRRARKDRVREIQWERDWRDEWERPFRRQHYRDHHDHWRSS
REEWDDERIRERDVVFDNRRPTYGYLR*
Coding >OphauG2|2241
ATGCCTCCTAGCCCAGCCCCACCCCCTCGTCCGCGAGCAAGAGATCGAGAAACAGACATTGACATTTCCTTGTCC
AAAAATCGCACCGAGGTGGATATCTACCAGTCGAATTCAAGGCCGCGCTCCAAGAGTCGTGACCGCCGTTCGCGA
TACCACGAAGACGATATCGTTGTTCGGCGGGACGGCGAACGTCTCCGAGTAGACGAGCATTCCTCTAGTTCACGT
CGACGAGCCCAATCAGCGGCGCCATCGACTATCCCCTTTGACGACAAGGCTGACCAAATTATAGCCAAGATTGAC
TCTCGTGGACGCATGGGCGAGTCGCGAGGCGGTGCAACCAAAGACTGGACCATTGTTGATGTGCCCCCAGGCACC
GAGAGAGTCCGCATGGACGGTATTGGAGGCGCAAGCACAGACACGACTTGGGAACGATATAGCGGAGTCAGGAGG
ACACAGTTCATTCCCGAGAGAGATGGGGCGCTTGTGCCCAGAGACCCATCTCCCGCGCCGGCACGAGATCGCTCC
AGCATGGCCGTCTACGACCGTGAACGTGAAATTGATGTTGACATTGATCGCCGAGTAACCAGATCACCCCTTCCA
CCACCGCCGCCGCCAGCTCCCGCCAAGGACATGTGGACCGAGATTACCAAGGATCTCGTCATGCGTGAGGCCATT
GAGGAATTGGGCTACGAGTATGAGGAGACGAGAGAGTTCTTTTACATCATGGACTACCTGAAATACGAAGATGTA
TGCGAGCTTACCGAGCGGTCTGAAAGTATCCGACGCGCCCGCAAGGATCGTGTGAGGGAGATTCAGTGGGAGCGA
GACTGGCGAGACGAATGGGAGCGGCCATTCAGACGCCAGCACTATCGTGACCACCACGACCACTGGAGGTCTTCG
CGTGAGGAATGGGATGATGAACGCATCAGGGAACGCGACGTGGTGTTTGACAACCGAAGGCCCACCTATGGCTAT
CTTCGCTAA
Transcript >OphauG2|2241
ATGCCTCCTAGCCCAGCCCCACCCCCTCGTCCGCGAGCAAGAGATCGAGAAACAGACATTGACATTTCCTTGTCC
AAAAATCGCACCGAGGTGGATATCTACCAGTCGAATTCAAGGCCGCGCTCCAAGAGTCGTGACCGCCGTTCGCGA
TACCACGAAGACGATATCGTTGTTCGGCGGGACGGCGAACGTCTCCGAGTAGACGAGCATTCCTCTAGTTCACGT
CGACGAGCCCAATCAGCGGCGCCATCGACTATCCCCTTTGACGACAAGGCTGACCAAATTATAGCCAAGATTGAC
TCTCGTGGACGCATGGGCGAGTCGCGAGGCGGTGCAACCAAAGACTGGACCATTGTTGATGTGCCCCCAGGCACC
GAGAGAGTCCGCATGGACGGTATTGGAGGCGCAAGCACAGACACGACTTGGGAACGATATAGCGGAGTCAGGAGG
ACACAGTTCATTCCCGAGAGAGATGGGGCGCTTGTGCCCAGAGACCCATCTCCCGCGCCGGCACGAGATCGCTCC
AGCATGGCCGTCTACGACCGTGAACGTGAAATTGATGTTGACATTGATCGCCGAGTAACCAGATCACCCCTTCCA
CCACCGCCGCCGCCAGCTCCCGCCAAGGACATGTGGACCGAGATTACCAAGGATCTCGTCATGCGTGAGGCCATT
GAGGAATTGGGCTACGAGTATGAGGAGACGAGAGAGTTCTTTTACATCATGGACTACCTGAAATACGAAGATGTA
TGCGAGCTTACCGAGCGGTCTGAAAGTATCCGACGCGCCCGCAAGGATCGTGTGAGGGAGATTCAGTGGGAGCGA
GACTGGCGAGACGAATGGGAGCGGCCATTCAGACGCCAGCACTATCGTGACCACCACGACCACTGGAGGTCTTCG
CGTGAGGAATGGGATGATGAACGCATCAGGGAACGCGACGTGGTGTTTGACAACCGAAGGCCCACCTATGGCTAT
CTTCGCTAA
Gene >OphauG2|2241
ATGCCTCCTAGCCCAGCCCCACCCCCTCGTCCGCGAGCAAGAGATCGAGAAACAGACATTGACATTTCCTTGTCC
AAAAATCGCACCGAGGTGGATATCTACCAGTCGAATTCAAGGCCGCGCTCCAAGAGTCGTGACCGCCGTTCGCGA
TACCACGAAGACGATATCGTTGTTCGGCGGGACGGCGAACGTCTCCGAGTAGACGAGCATTCCTCTAGTTCACGT
CGACGAGCCCAATCAGCGGCGCCATCGACTATCCCCTTTGACGACAAGGCTGACCAAATTATAGCCAAGATTGAC
TCTCGTGGACGCATGGGCGAGTCGCGAGGCGGTGCAACCAAAGACTGGACCATTGTTGATGTGCCCCCAGGCACC
GAGAGAGTCCGCATGGACGGTATTGGAGGCGCAAGCACAGACACGACTTGGGAACGATATAGCGGAGTCAGGAGG
ACACAGTTCATTCCCGAGAGAGATGGGGCGCTTGTGCCCAGAGACCCATCTCCCGCGCCGGCACGAGATCGCTCC
AGCATGGCCGTCTACGACCGTGAACGTGAAATTGATGTTGACATTGATCGCCGAGTAACCAGATCACCCCTTCCA
CCACCGCCGCCGCCAGCTCCCGCCAAGGACATGTGGACCGAGATTACCAAGGATCTCGTCATGCGTGAGGCCATT
GAGGAATTGGGCTACGAGTATGAGGAGACGAGAGAGTTCTTTTACATCATGGACTACCTGAAATACGTAAGCGCC
TCAATCATGACGAATCACACGGCCAGTACACTGATGTTTCTGCAGGAAGATGTATGCGAGCTTACCGAGCGGTCT
GAAAGTATCCGACGCGCCCGCAAGGATCGTGTGAGGGAGATTCAGTGGGAGCGAGACTGGCGAGACGAATGGGAG
CGGCCATTCAGACGCCAGCACTATCGTGACCACCACGACCACTGGAGGTCTTCGCGTGAGGAATGGGATGATGAA
CGCATCAGGGAACGCGACGTGGTGTTTGACAACCGAAGGCCCACCTATGGCTATCTTCGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail