Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2237
Gene name
LocationContig_178:19000..19943
Strand-
Gene length (bp)943
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 3.8E-12 36 170
PF13649 Methyltransf_25 Methyltransferase domain 1.4E-09 50 153
PF08241 Methyltransf_11 Methyltransferase domain 3.0E-09 50 157
PF08242 Methyltransf_12 Methyltransferase domain 6.5E-08 50 155
PF13847 Methyltransf_31 Methyltransferase domain 1.8E-06 47 160
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 4.1E-05 9 160

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94628|YGE9_SCHPO Uncharacterized methyltransferase C1347.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1347.09 PE=3 SV=1 49 197 9.0E-19

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2237
MSETTAVNKAYFDKAAADYDDKFQSLCAKLEAELKARAHLLGADTRGRLLDYACGTGLISQAIGNSFDQCVGIDL
SDKMVQSYNAKAQSQGLFPTLRQAHVGNLVDPADPDPTGLSIPLFHDFDAAGVALGFHHFDDCALAARRLAERLR
PNGLFFVVDFLPHGSMDRHQEAARGVTHHGFGEARMRGLFEQAGVASHFSFDVVAGDVVSGHMGPAGCNVVPRLF
VAIGRKA*
Coding >OphauG2|2237
ATGTCTGAAACAACAGCAGTCAACAAGGCCTACTTTGACAAGGCCGCAGCAGACTACGATGACAAATTCCAGAGC
CTCTGTGCAAAACTCGAGGCCGAACTGAAAGCCCGGGCGCACCTCCTCGGCGCGGACACCCGAGGCCGTCTGCTC
GACTATGCGTGCGGCACGGGGCTCATATCACAGGCCATCGGCAACAGCTTTGACCAGTGCGTGGGCATCGACCTG
TCGGACAAGATGGTGCAAAGCTACAACGCCAAAGCGCAGAGCCAAGGCCTCTTCCCCACCCTCCGCCAAGCCCAC
GTCGGCAACCTTGTCGACCCCGCCGACCCCGATCCCACTGGGCTGTCCATCCCTCTCTTCCACGACTTTGACGCA
GCTGGCGTTGCCCTCGGCTTCCATCACTTTGACGACTGCGCCCTCGCCGCCCGGCGCCTCGCTGAGCGCCTGCGT
CCCAACGGCCTTTTCTTCGTCGTCGACTTTTTGCCCCATGGCTCCATGGACCGGCATCAAGAGGCGGCACGCGGC
GTCACGCACCATGGCTTTGGCGAGGCCCGCATGAGAGGCCTCTTTGAGCAGGCCGGTGTCGCCTCGCATTTTAGC
TTTGACGTCGTGGCGGGAGACGTTGTCTCTGGCCACATGGGGCCGGCTGGGTGTAACGTAGTGCCGAGGTTATTC
GTCGCCATTGGTCGCAAGGCATAG
Transcript >OphauG2|2237
ATGTCTGAAACAACAGCAGTCAACAAGGCCTACTTTGACAAGGCCGCAGCAGACTACGATGACAAATTCCAGAGC
CTCTGTGCAAAACTCGAGGCCGAACTGAAAGCCCGGGCGCACCTCCTCGGCGCGGACACCCGAGGCCGTCTGCTC
GACTATGCGTGCGGCACGGGGCTCATATCACAGGCCATCGGCAACAGCTTTGACCAGTGCGTGGGCATCGACCTG
TCGGACAAGATGGTGCAAAGCTACAACGCCAAAGCGCAGAGCCAAGGCCTCTTCCCCACCCTCCGCCAAGCCCAC
GTCGGCAACCTTGTCGACCCCGCCGACCCCGATCCCACTGGGCTGTCCATCCCTCTCTTCCACGACTTTGACGCA
GCTGGCGTTGCCCTCGGCTTCCATCACTTTGACGACTGCGCCCTCGCCGCCCGGCGCCTCGCTGAGCGCCTGCGT
CCCAACGGCCTTTTCTTCGTCGTCGACTTTTTGCCCCATGGCTCCATGGACCGGCATCAAGAGGCGGCACGCGGC
GTCACGCACCATGGCTTTGGCGAGGCCCGCATGAGAGGCCTCTTTGAGCAGGCCGGTGTCGCCTCGCATTTTAGC
TTTGACGTCGTGGCGGGAGACGTTGTCTCTGGCCACATGGGGCCGGCTGGGTGTAACGTAGTGCCGAGGTTATTC
GTCGCCATTGGTCGCAAGGCATAG
Gene >OphauG2|2237
ATGTCTGAAACAACAGCAGTCAACAAGGCCTACTTTGAGTCTGTCGCGTCCCCCCCAGTGCTTGTATGGCGTGTA
AAGGCCGGGTAGAGGGTTGGCTAATAGTTTTTGGTATGCAACAAAAATCAACTATAGCAAGGCCGCAGCAGACTA
CGATGACAAATTCCAGAGCCTCTGTGCAAAACTCGAGGCCGAACTGAAAGCCCGGGCGCACCTCCTCGGCGCGGA
CACCCGAGGCCGTCTGCTCGACTATGCGTGCGGCACGGGGCTCATATCACAGGTATTGCAGGGCCGAGTAGAGCA
TGGCATTGGACCACCCTGGTGACGTTTGTTGGCTTTGGTTTTGCCAGGCCATCGGCAACAGCTTTGACCAGTGCG
TGGGCATCGACCTGTCGGACAAGATGGTGCAAAGCTACAACGCCAAAGCGCAGAGCCAAGTCTGCTCCCTTTCTC
CCCCCTCGATGCATCCATTGCCCATCAACCTTGTTGTCCTCGACACTCACCAATCCCTCGGCAGGGCCTCTTCCC
CACCCTCCGCCAAGCCCACGTCGGCAACCTTGTCGACCCCGCCGACCCCGATCCCACTGGGCTGTCCATCCCTCT
CTTCCACGACTTTGACGCAGCTGGCGTTGCCCTCGGCTTCCATCACTTTGACGACTGCGCCCTCGCCGCCCGGCG
CCTCGCTGAGCGCCTGCGTCCCAACGGCCTTTTCTTCGTCGTCGACTTTTTGCCCCATGGCTCCATGGACCGGCA
TCAAGAGGCGGCACGCGGCGTCACGCACCATGGCTTTGGCGAGGCCCGCATGAGAGGCCTCTTTGAGCAGGCCGG
TGTCGCCTCGCATTTTAGCTTTGACGTCGTGGCGGGAGACGTTGTCTCTGGCCACATGGGGCCGGCTGGGTGTAA
CGTAGTGCCGAGGTTATTCGTCGCCATTGGTCGCAAGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail