Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2236
Gene name
LocationContig_178:16984..18592
Strand+
Gene length (bp)1608
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 6.1E-17 6 81
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 3.6E-16 99 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36136|SHB17_YEAST Sedoheptulose 1,7-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHB17 PE=1 SV=1 1 251 1.0E-49
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 6 201 4.0E-13
sp|Q11SV1|GPMA_CYTH3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gpmA PE=3 SV=1 4 203 2.0E-11
sp|B2IEV6|GPMA_BEII9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gpmA PE=3 SV=1 6 221 2.0E-09
sp|B0UBD4|GPMA_METS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium sp. (strain 4-46) GN=gpmA PE=3 SV=1 6 221 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36136|SHB17_YEAST Sedoheptulose 1,7-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHB17 PE=1 SV=1 1 251 1.0E-49
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 6 201 4.0E-13
sp|Q11SV1|GPMA_CYTH3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gpmA PE=3 SV=1 4 203 2.0E-11
sp|B2IEV6|GPMA_BEII9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gpmA PE=3 SV=1 6 221 2.0E-09
sp|B0UBD4|GPMA_METS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium sp. (strain 4-46) GN=gpmA PE=3 SV=1 6 221 3.0E-09
sp|A4YJP8|GPMA_BRASO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain ORS278) GN=gpmA PE=3 SV=1 6 203 8.0E-09
sp|B2S2B5|GPMA_TREPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gpmA PE=3 SV=1 5 201 3.0E-08
sp|P96121|GPMA_TREPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum (strain Nichols) GN=gpmA PE=3 SV=1 5 201 3.0E-08
sp|Q89WK1|GPMA_BRADU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gpmA PE=3 SV=1 6 203 3.0E-08
sp|B6JCI9|GPMA_OLICO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gpmA PE=3 SV=1 1 203 4.0E-08
sp|B5ZWT2|GPMA_RHILW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gpmA PE=3 SV=1 6 223 4.0E-08
sp|Q3JBA8|GPMA_NITOC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gpmA PE=3 SV=1 6 212 5.0E-08
sp|B8EML2|GPMA_METSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gpmA PE=3 SV=1 6 221 7.0E-08
sp|Q11CB5|GPMA_CHESB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chelativorans sp. (strain BNC1) GN=gpmA PE=3 SV=1 6 203 1.0E-07
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 6 203 1.0E-07
sp|Q3SW71|GPMA_NITWN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gpmA PE=3 SV=1 6 203 1.0E-07
sp|A7HZ35|GPMA_PARL1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gpmA PE=3 SV=1 1 204 2.0E-07
sp|A5E8K1|GPMA_BRASB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gpmA PE=3 SV=1 6 203 2.0E-07
sp|B9JYQ2|GPMA_AGRVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gpmA PE=3 SV=1 3 203 3.0E-07
sp|Q6MEW4|GPMA_PARUW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Protochlamydia amoebophila (strain UWE25) GN=gpmA PE=3 SV=1 5 230 3.0E-07
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 3 241 3.0E-07
sp|B1M6A7|GPMA_METRJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gpmA PE=3 SV=1 6 221 3.0E-07
sp|C3MBY8|GPMA_RHISN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium sp. (strain NGR234) GN=gpmA PE=3 SV=1 6 203 3.0E-07
sp|A7IC75|GPMA_XANP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gpmA PE=3 SV=1 6 203 4.0E-07
sp|P59160|GPMA_BRUSU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis biovar 1 (strain 1330) GN=gpmA PE=3 SV=1 6 209 5.0E-07
sp|A9WW62|GPMA_BRUSI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gpmA PE=3 SV=1 6 209 5.0E-07
sp|Q8YDC9|GPMA_BRUME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gpmA PE=3 SV=2 6 209 5.0E-07
sp|C0RMJ1|GPMA_BRUMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gpmA PE=3 SV=1 6 209 5.0E-07
sp|A9MCX8|GPMA_BRUC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gpmA PE=3 SV=1 6 209 5.0E-07
sp|Q576R3|GPMA_BRUAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus biovar 1 (strain 9-941) GN=gpmA PE=3 SV=1 6 209 5.0E-07
sp|Q2YJN6|GPMA_BRUA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain 2308) GN=gpmA PE=3 SV=1 6 209 5.0E-07
sp|B2SC37|GPMA_BRUA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain S19) GN=gpmA PE=3 SV=1 6 209 5.0E-07
sp|A6WYJ2|GPMA_OCHA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gpmA PE=3 SV=1 6 209 5.0E-07
sp|A1UTM4|GPMA_BARBK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gpmA PE=3 SV=1 6 212 6.0E-07
sp|A6UEW3|GPMA_SINMW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sinorhizobium medicae (strain WSM419) GN=gpmA PE=3 SV=1 6 221 6.0E-07
sp|Q6FZ12|GPMA_BARQU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella quintana (strain Toulouse) GN=gpmA PE=3 SV=1 6 212 7.0E-07
sp|Q7N900|GPMB_PHOLL Probable phosphoglycerate mutase GpmB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmB PE=3 SV=1 5 230 8.0E-07
sp|B9J6R3|GPMA_AGRRK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=gpmA PE=3 SV=1 6 203 8.0E-07
sp|Q92T25|GPMA_RHIME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium meliloti (strain 1021) GN=gpmA PE=3 SV=1 6 203 8.0E-07
sp|A8G9J4|GPMB_SERP5 Probable phosphoglycerate mutase GpmB OS=Serratia proteamaculans (strain 568) GN=gpmB PE=3 SV=1 5 75 2.0E-06
sp|Q07UT3|GPMA_RHOP5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain BisA53) GN=gpmA PE=3 SV=1 6 203 2.0E-06
sp|A5VVV5|GPMA_BRUO2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gpmA PE=3 SV=1 6 209 2.0E-06
sp|Q9A634|GPMA_CAUCR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gpmA PE=3 SV=1 4 201 2.0E-06
sp|B8GYN6|GPMA_CAUCN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=gpmA PE=3 SV=1 4 201 2.0E-06
sp|Q21CH5|GPMA_RHOPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain BisB18) GN=gpmA PE=3 SV=1 6 203 2.0E-06
sp|B1ZA86|GPMA_METPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gpmA PE=3 SV=1 6 211 3.0E-06
sp|P36623|PMGY_SCHPO Phosphoglycerate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpm1 PE=1 SV=1 6 209 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6727
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2236 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|715
Ophiocordyceps subramaniannii Hirsu2|7171

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2236
MPTPRVFLVRHGETEWSLSGRHTGRTDIPLTANGERRVRATGRALVGSDRLIVPRQLSHIYVSPRKRAQRTFELL
NLGVPPEALPWSSHGSTACTGIDCNAGIQVCEAIREWDYGDYEGVTTPEIRKRRAAEGIEGTWDIWRDGCPGGES
PAQVTQRLDELIIEIRQKWQRDVLQGQTKGPGGVGCGDVLIVAHGHILRAFAMRWVGKTLQEGPAFLLEAGGVGT
LSYEHHSIEEPAILLGGAFVVDIAEE*
Coding >OphauG2|2236
ATGCCAACGCCTCGCGTCTTTCTTGTCCGCCACGGCGAGACGGAATGGTCTCTCAGCGGACGCCACACGGGCCGA
ACCGATATCCCGCTGACGGCAAATGGCGAAAGGCGTGTGCGAGCGACGGGCCGAGCCCTGGTGGGCAGTGATCGC
CTTATTGTTCCTCGCCAGCTCTCCCACATATACGTGTCGCCGCGGAAGCGCGCCCAGCGCACCTTTGAGCTCCTC
AACCTGGGCGTGCCGCCCGAGGCGCTGCCCTGGTCCTCACACGGCTCCACGGCCTGCACTGGCATAGACTGCAAC
GCCGGCATCCAGGTTTGCGAGGCGATACGCGAGTGGGACTATGGCGATTACGAGGGCGTCACGACGCCAGAGATT
CGCAAGCGACGGGCTGCCGAGGGCATCGAGGGGACCTGGGATATTTGGCGAGACGGGTGTCCTGGTGGCGAGAGT
CCAGCACAAGTCACCCAGCGTCTCGACGAGCTTATTATCGAGATTCGGCAAAAATGGCAGCGGGACGTCCTCCAA
GGCCAGACAAAAGGTCCAGGCGGTGTAGGCTGCGGCGACGTGCTCATTGTGGCTCACGGACATATCTTGCGTGCT
TTTGCCATGCGTTGGGTGGGTAAGACGCTTCAGGAGGGACCGGCCTTTTTGCTCGAGGCTGGAGGTGTTGGAACG
CTGAGCTACGAGCATCACAGTATAGAGGAGCCGGCTATTCTTCTCGGCGGAGCATTTGTGGTTGACATTGCTGAA
GAGTGA
Transcript >OphauG2|2236
ATGCCAACGCCTCGCGTCTTTCTTGTCCGCCACGGCGAGACGGAATGGTCTCTCAGCGGACGCCACACGGGCCGA
ACCGATATCCCGCTGACGGCAAATGGCGAAAGGCGTGTGCGAGCGACGGGCCGAGCCCTGGTGGGCAGTGATCGC
CTTATTGTTCCTCGCCAGCTCTCCCACATATACGTGTCGCCGCGGAAGCGCGCCCAGCGCACCTTTGAGCTCCTC
AACCTGGGCGTGCCGCCCGAGGCGCTGCCCTGGTCCTCACACGGCTCCACGGCCTGCACTGGCATAGACTGCAAC
GCCGGCATCCAGGTTTGCGAGGCGATACGCGAGTGGGACTATGGCGATTACGAGGGCGTCACGACGCCAGAGATT
CGCAAGCGACGGGCTGCCGAGGGCATCGAGGGGACCTGGGATATTTGGCGAGACGGGTGTCCTGGTGGCGAGAGT
CCAGCACAAGTCACCCAGCGTCTCGACGAGCTTATTATCGAGATTCGGCAAAAATGGCAGCGGGACGTCCTCCAA
GGCCAGACAAAAGGTCCAGGCGGTGTAGGCTGCGGCGACGTGCTCATTGTGGCTCACGGACATATCTTGCGTGCT
TTTGCCATGCGTTGGGTGGGTAAGACGCTTCAGGAGGGACCGGCCTTTTTGCTCGAGGCTGGAGGTGTTGGAACG
CTGAGCTACGAGCATCACAGTATAGAGGAGCCGGCTATTCTTCTCGGCGGAGCATTTGTGGTTGACATTGCTGAA
GAGTGA
Gene >OphauG2|2236
ATGCCAACGCCTCGCGTCTTTCTTGTCCGCCACGGCGAGACGGAATGGTCTCTCAGCGGACGCCACACGGGCCGA
ACCGATATCCCGCTGACGGCAAATGGCGAAAGGCGTGTGCGAGCGACGGGCCGAGCCCTGGTGGGCAGTGATCGC
CTTATTGTTCCTCGCCAGCTCTCCCACATGTACGTCTGGCTCTGCCGCTGGTGGCAGCAAGTGAGGGGGCAACTG
TGCACACCAAGGATTCTACATACACACACATAGACACTCGAGGCAAAGGAAAGCAAGGAGGGGGGGATCGAGACA
GGAATGCCCAGCAGGCAAGACGGAGACACCAGACGAGAGCACGGCCACGGGCTGGACTCCCCCTCTCTCCAGTGG
CTTGCTCGCTTGGCCTCCTATGCCGTGCCGCTGTGCCATGTTGCTCGCCAAGTGGCAAAGAGGGAGTGCAGCCAT
GGAATGCCGTGCAGCTTGCTTGCATCCAAGTCAGCAGCGCCTTGTGACAGGCAACCTGCTGTGCCAAGTGACGAT
GCAACGCTGCTTGCATACGGTCCGCCGTGCAACGTCTGTCTGCATCCGCCGTGCATCCGCCGTGCATGGTGGCAT
CTACACGCCCCCTCCTTTCCCCCATGCCCTCTCCCATTACCCTGTTTCCTTGCCCTCTTTAAGCCTATTGCAGAA
ACACTTCAACTCACACACAAGCCTCCTTGGTGTCTCTTTTTTTTTGCAGATACGTGTCGCCGCGGAAGCGCGCCC
AGCGCACCTTTGAGCTCCTCAACCTGGGCGTGCCGCCCGAGGCGCTGCCCTGGTCCTCACACGGCTCCACGGCCT
GCACTGGCATAGACTGCAACGCCGGCATCCAGGTTTGCGAGGCGATACGCGAGTGGGACTATGGCGATTACGAGG
GCGTCACGACGCCAGAGATTCGCAAGCGACGGGCTGCCGAGGGCATCGAGGGGACCTGGGATATTTGGCGAGACG
GGTGTCCTGGTGGCGAGTAAGTTTTTCCCCCCCTTGCTTGTTTCCTTTTTCTTTTCTTTTCTTTTCTTTTCTTTT
TTTTTTTTTTAAAAAAAAGACATGCGTCTGTTTCTTGCAGAGATGTTCTTGTCTAGAAAAAAAAGAAATATTAAA
AAAAAGGGGCTCAAGGGAGCCCCGAGCGTTGCATGGCACATGTGCTGAGTCTTGATGTAGGAGTCCAGCACAAGT
CACCCAGCGTCTCGACGAGCTTATTATCGAGATTCGGCAAAAATGGCAGCGGGACGTCCTCCAAGGCCAGACAAA
AGGTCCAGGCGGTGTAGGCTGCGGCGACGTGCTCATTGTGGCTCACGGACATATCTTGCGTGCTTTTGCCATGCG
TTGGGTGGGTAAGACGCTTCAGGAGGGACCGGCCTTTTTGCTCGAGGCTGGAGGTGTTGGAACGCTGAGGTGAGT
TGTTTGTCTGGCAGCGCCCGTCTCCTTCTTTCACATGTTGGGCTCTGCATTTGGGAAGAGGGTCATGAGGGCTAA
TGTGGGCGTCTCTTTTTTTTTCCCTTGGCTAGCTACGAGCATCACAGTATAGAGGAGCCGGCTATTCTTCTCGGC
GGAGCATTTGTGGTTGACATTGCTGAAGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail